CAZyme Information: MGYG000001896_01061

Basic Information

• Species: UMGS1840 sp900555525
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; UMGS1840; UMGS1840 sp900555525
• CAZyme ID: MGYG000001896_01061
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000001896_63|CGC1	44900.16	6.238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001896	2208881	MAG	Denmark	Europe

• Gene Location: Start: 273; End: 1469 Strand: -

Full Sequence      

MDKIKIGYVGLGGRGLGILKDIILPQNMAEITAVCDVYKDRAEHGAKIVTDAKKPAPKIY
TDYREVIADENVNTIIVTAAWEAHTEIALAAMRAGKAVAIEVGGAYTVEQCWELVKTYEE
TKTPFMFLENCCFGRREMMVLNMKEQGVFGEIVHCSGGYQHDLRNEIAFGRENRHYRLRN
YIHRNCENYPTHEFGPLAKVLGINHGNRMLTLSSTASKSAGLKEYIKNEKSDDEVLKNTH
FNQGDIVTTVIKCAGGETVVLTLDTTLPRYYSRGFTVRGTKGLYEEYTDSVFLDNGEDSK
KDFAWRKECTGNAEKYEEKYDHPVWKEYLKQGVKGSHDGMDWLQFQTFFDCLKNDKPMPI
DVYDAAAMMVITPLSEMSIAKGGAVMDVPDFTSGKWHL

Enzyme Prediction     

No EC number prediction in MGYG000001896_01061.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	397	6.9e-147	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.62e-19	26	385	27	338	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.45e-07	11	126	8	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	2.07e-179	1	396	1	395
QIB57148.1	1.62e-173	1	398	1	391
QMW80076.1	1.62e-173	1	398	1	391
QBE96673.1	1.62e-173	1	398	1	391
ALS29040.1	1.70e-172	2	396	3	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.49e-101	3	396	20	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	7.30e-67	1	396	40	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	4.41e-11	4	120	24	136	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3E18_A	4.50e-10	1	170	3	170	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3NTO_A	3.18e-09	3	156	2	154	Crystalstructure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis [Bacillus subtilis],3NTQ_A Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTQ_B Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTR_A Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis],3NTR_B Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.37e-100	3	396	20	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	1.32e-94	3	396	49	457	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	7.86e-94	4	396	53	459	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
B2FLK4	8.29e-93	3	396	33	441	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	1.99e-83	4	397	43	433	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001896_01061.