CAZyme Information: MGYG000001888_00100

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS775
• CAZyme ID: MGYG000001888_00100
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828	MGYG000001888_11|CGC1	93135.86	5.2933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001888	1136142	MAG	Denmark	Europe

• Gene Location: Start: 1080; End: 3566 Strand: +

Full Sequence      

MIYKGKNTKNISFPLGGIGTGSIGIAGNGELVDWEIFNRPNKNSKNGFSHFAVKAKKGDK
SIAKVLQGDVVKDLSGPTINGFFAGFGFGPLQTTMGGFPHFENVVFQGEFPLARLKFSDA
DFFGKITLTAFNPFIPHNDYDSSLPAAFFIVEIENDADEAVDYTLAFSVRNPAERSLNGK
FSENGVTGVFFGNALDEEDLHYGDLTVVSDGGDCSVTENWYRGGWNDPHTVYWRNFTEND
RQPERNYNGEGNAEHASVFVYASLPPKTRKKFRFVLAWNTPNNVNDWTPLAEGETERDAR
WKNYYARCFKNSKETALYAMKHFDRLYKATVRFKNALFSSSLPKTVLDAVSANLSILKSP
TVLRLEDGAFYGWEGVMEKQGSCEGTCQHVWNYAYALCYLFPALERSLRETVYKYNTFED
GETAFRSVLPLGRKRPVKFRACVDGQMGEVIKSYREWKICGDGEWLKKHWRSIKKMIAYA
WAETNADRWDADGDGVLDGRQHHTLDMELFGANTWLEGMYLLALDCGREMAEAVGDADAA
ETFGKKYEYGRKWMNENLFNGSYFVQKIDIRDKNIPAEYGAEDYWNEEAGEIKYQYADGC
EIDQMLADWHAAILGVRGVFDKDKKRTALESLYRNNFKTSMRNVENMWRLFTLNDESGAI
ICDYPEGAYKPVIPLPYCEETMAGFEYALAGLMIAEGMKEEGEPLVKAVRTRYDGEKRNP
WNEMECGSNYARSMASFALLPVYSGFICDMPNSRIGFRPIEKSGCFLWSAGEAWGTVAVN
AGGVTFRVEGGRIALSSFAFPQDKTALALSVDGKKTAFTAAAGEIYFP

Enzyme Prediction     

No EC number prediction in MGYG000001888_00100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	371	739	1.4e-56	0.9889807162534435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	7.15e-43	29	326	18	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	1.75e-40	390	739	19	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	4.13e-37	14	747	16	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT59778.1	8.55e-303	3	827	5	847
AZN43107.1	1.25e-302	3	827	5	847
CCO21811.1	6.48e-292	3	803	6	827
BBH18759.1	4.26e-291	2	801	4	820
QGQ98288.1	3.54e-289	2	828	4	855

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M868	1.16e-11	14	564	144	727	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q69ZF3	1.52e-11	14	744	144	876	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q9HCG7	3.47e-11	14	744	153	885	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	7.34e-08	106	701	223	890	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000039	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001888_00100.