CAZyme Information: MGYG000001887_00736

Basic Information

• Species: Ruminiclostridium_E sp003512525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp003512525
• CAZyme ID: MGYG000001887_00736
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		37327.31	4.91

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001887	2739679	MAG	Denmark	Europe

• Gene Location: Start: 25421; End: 26392 Strand: +

Full Sequence      

MMSDKLYIPSNPNAQRGVRNVLKYLSDITYEKIVTGQHTQTMAQEELRLIEKVTGKQPAL
IGFELLSYSPNINYSDTDDECMTEVAENYGTLKRAWEWAEKKGLITMCWHWFSPLYGRSK
SFFSENTEFDASKAVIDGTPENNALLSDMDTMAGILRPFCEKGVPILWRPFHEGDGDWFW
WGKKGADTVKKLFRLMHDRYTNKFHLDNLIWVWNSQIPECYPGDDVVDIISRDMYPPEHE
HTSQSDMYYNLCKITSANKITIIGETGTLPSPEAIAAEKVGWSSYMTWSKTFCLTEQFNT
FEQLKKVYNSEFAVTKDELPVLY

Enzyme Prediction     

No EC number prediction in MGYG000001887_00736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	10	318	2.5e-96	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	9.34e-49	11	318	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.62e-13	163	235	179	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34621.1	4.18e-236	2	323	1	322
CBK96616.1	8.44e-236	2	323	1	322
QTE69139.1	2.26e-157	9	323	7	321
ADU22555.1	1.28e-154	9	323	8	322
AIQ67637.1	5.10e-138	9	323	9	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.59e-65	9	321	6	312	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	6.34e-60	9	320	34	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	3.23e-58	10	319	146	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	4.71e-41	50	288	87	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	8.44e-41	9	319	23	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	7.87e-62	10	319	175	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.93e-58	9	319	28	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.53e-51	10	320	147	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.58e-49	19	309	38	323	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	1.55e-44	11	320	159	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001887_00736.