CAZyme Information: MGYG000001883_00039

Basic Information

• Species: UMGS1781 sp900555075
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1781; UMGS1781 sp900555075
• CAZyme ID: MGYG000001883_00039
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	MGYG000001883_1|CGC2	50401.88	9.717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001883	1201749	MAG	Denmark	Europe

• Gene Location: Start: 44519; End: 45802 Strand: +

Full Sequence      

MKDKISKFKSLIKKYGILGTIKKVLNYVFSIIMNILHSLNFIENKKLSKSLDEIIENKNY
DRIIIWRSNFGWNVPLFQRPQHIALNLAKQKCLVFYEVTHFTDKIRGIKKANDNLVLINL
ENKSVQKLLFTKLKNTNKPKYIQIYSTDWNMKLEELKQYIQSGYKIIYEYIDEINPILSG
TKEIPVNIKEKYEYMLQDKKNVFVVVTADKLKQDIEQKRGKEKLVFACNGVDYEHYQNID
KDFKFDDGFQKILDEKKPIIGYYGAFASWFDYNCIKNLAIKRPEYNIVLIGTKYDNSLEK
SKIEEMKNIYFLGARDYKILKNYAAKFDVCTVPFIINDITKATSPLKIFEYMALSKPIVT
TAMDECKKYKSIFIAKNSQEFVELIDKALKLNKQTDIEYFKTLEQEALENTWENKARKII
NLLKKEE

Enzyme Prediction     

No EC number prediction in MGYG000001883_00039.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04950	GT4_TuaH-like	1.37e-57	61	423	3	369	teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03794	GT4_WbuB-like	1.44e-12	204	420	167	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	1.07e-10	156	425	106	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.20e-09	204	424	144	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13692	Glyco_trans_1_4	3.30e-06	257	362	1	104	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPJ84509.1	2.88e-111	51	424	2	370
AMN34493.1	1.19e-108	49	424	101	474
QQA12087.1	1.62e-107	11	425	13	425
AMN31646.1	1.62e-107	11	425	13	425
BAB79977.1	1.62e-107	11	425	13	425

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32267	1.05e-12	204	383	170	344	Putative teichuronic acid biosynthesis glycosyltransferase TuaH OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999746	0.000250	0.000016	0.000001	0.000001	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001883_00039.