CAZyme Information: MGYG000001876_01595

Basic Information

• Species: Acetatifactor sp900760705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900760705
• CAZyme ID: MGYG000001876_01595
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898	MGYG000001876_38|CGC1	102758.13	4.8643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001876	3172346	MAG	Denmark	Europe

• Gene Location: Start: 17760; End: 20456 Strand: +

Full Sequence      

MKLHPLDGRINKGFTTWGCMWKQGECSADTEYICRDSVGKEVPMQSRITAWWPDGSVKWT
AHTADSELCGEEIEVLPAETIEGKACTCVEKQNPAQDGNGQIKVSGYEDGQGIAITETEE
MLTLDCGLLKVEIEKKGRYLFRKVTRNGKDCGYEARPRLILEEPVVVNGRKGCVEKEYWG
RVDSVVLEEQGPMECVVKYEGTHVDESNGEERLPFIIRMRVNYDGPELRFTHTFFYDGDE
NKDWLKGLGICFNVPGAGGDYNRHVKVTGDHGVLHEMSVNTISWHPRIPQELHERQVAGE
CLQLDETEKEILDEVMAACPHFDIYDIYQDSVSHYAVKKKLAGEEFCFLDCEDGYRTQGG
VAVGTEAGSVMLCIRDFWEKYPSGYTVSGLTKDKLSVDIWLWSPGAKAFDFRHYAPRGYN
QVCYEGYDYKGADPVGIACTNECAVAFREEMIPEDQELLDFTESVNHPAQYVGTPEFYHE
MKAFGYWSLPGGKTEMEKWLEEQLETCFAFYKNEVEQRGWYGMFNYGDFMHTYDPARHKW
RYDVGGFAWDNTELVPTLWLWLYFMRTGRGDVFTLAEKLCRHASEVDVYHMGKYKGLGSR
HNVRHWGCPCKEARIAMAGHHRYLYYMTGDYRFGDIFEELKDNEFSFLNKDPMGDFYEKK
DMVFPSHARSGPDWSSLCSNWMTRWERFNDTVYRDKILVGIEDIKKAPLKLVSGCDFEFD
PASCHLRYIGERTAGGSHLQICMGAPEIWTELADLLEDKEWKDMVAGLGRFYFLPREEQF
AESGGIIGSREFSFPFMASGIGAYGASYLKDEKLAERVWKALLATILSENDERGFDTIIT
KNQGNRENLVEIPWLSTNFAAQFCLNVIMCLEFIRKALPKTMEEAKALIEGSTGFHKA

Enzyme Prediction     

No EC number prediction in MGYG000001876_01595.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	14	878	1.5e-285	0.9825986078886311

CDD Domains     

MGYG000001876_01595 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94257.1	0.0	20	898	1	854
AEC02734.1	0.0	1	898	3	911
AOZ96961.1	1.30e-314	1	883	1	861
ABX43437.1	3.31e-312	1	881	5	876
AGC67247.1	4.50e-237	7	872	12	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	1.63e-127	16	878	24	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	2.39e-126	16	878	24	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	2.50e-126	16	878	24	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	9.13e-126	16	878	24	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	2.00e-219	2	883	3	851	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999938	0.000123	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001876_01595.