CAZyme Information: MGYG000001876_00889

Basic Information

• Species: Acetatifactor sp900760705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900760705
• CAZyme ID: MGYG000001876_00889
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	MGYG000001876_16|CGC2	86892.94	5.8772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001876	3172346	MAG	Denmark	Europe

• Gene Location: Start: 42123; End: 44504 Strand: +

Full Sequence      

MSIRETISGMSLQDKVAFCTGADFWQTKKMEKYGIPAIMMADGPHGLRCQKGETDMVGVN
KSLPATCFPAAVTAGATWDESLYAEEGAAIGQEGLAANVPLILGPGCNIKRNPLGGRNFE
YLSEDPYVAGKMAAAFIRGMQSTGASASLKHFAANSQEYKRMNGDSQVDERTLREIYLSA
FELAVREGHPATVMCAYNKINGEHCSDSKKLLTDILRFDWGFNGLVVTDWGAMNDRIKAF
QAGCDLNMPGGSDYMEQAVLRAVQNGTLSEADIDASVERILHLVERAGNALAVTVDWDGH
HALAQRVAEQGAVLLKNEDGLLPISDPDIVLIGYMAKNIRYQGSGSSHINPTRLVSLTDA
MPDAPFVACCDAEGVVTADGLREAVAAAKSHSVAVVVAGLPDAYESEAVDREHMSLPEGH
NRMIDAVAQSNPNTVVVLLGGSPMELPWADKVKAILYMGLSGQAGGQAAANLLTGRVNPS
GKLTETWPLSYADVVSKETFGKRNVEYRESIYVGYRYYDKADKPVRYPFGHGLSYTSFTY
SDLLIDGRTVRFNITNSGAVNGSEVAQLYISPPETGLHRPRRELKGFVKVYLMPGETKTI
EMELNDRSFSVWSDGWKIPGGTYTVQIGASCRDIRLQTEIKLNGEAVPIPEWQLGSWYET
LRALPNREEWERLMGHLVAIMPEPRKGQFTMDNSCFEMKDSSFIMKVQYKVTEHIIAKDF
GGKKDLSNPAYRMMLISAVDCPIRTSIINSTGLMSDSLGRGLLLMANGHIMKGLEQICFP
AKKHNTRKEEDER

Enzyme Prediction     

No EC number prediction in MGYG000001876_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	8.3e-70	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	8.91e-78	34	356	59	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	1.73e-76	66	638	118	761	beta-glucosidase BglX.
PLN03080	PLN03080	8.71e-70	4	628	54	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	8.50e-62	312	535	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.34e-46	26	283	57	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC67350.1	5.56e-276	10	777	1	744
ANW97844.1	5.56e-276	10	777	1	744
AGI38411.1	5.56e-276	10	777	1	744
ANX00396.1	1.58e-275	10	777	1	744
QFZ20634.1	6.87e-234	12	774	15	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	8.53e-206	1	643	3	669	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.40e-167	6	657	8	681	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.33e-117	3	645	4	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.48e-116	3	645	4	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	4.52e-110	3	645	6	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.67e-205	1	643	3	669	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	9.36e-163	2	657	4	690	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.86e-162	2	657	4	690	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q4WU49	3.50e-125	1	627	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
B0Y3M6	3.50e-125	1	627	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001876_00889.