CAZyme Information: MGYG000001873_00069

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia
• CAZyme ID: MGYG000001873_00069
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000001873_3|CGC1	78200.88	4.9104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001873	2665919	MAG	Denmark	Europe

• Gene Location: Start: 11674; End: 13713 Strand: -

Full Sequence      

MEKKYTASGKISDVSISGGLFGRVSRLVKEQVLPYQWDILNDTATNAVPDHSIENFSVAE
GNDEGYPSHCIANFRIAAKDQEGDFYGMVFQDSDLAKWLEAVAYRLMSEPDAELEKTVDE
TIDLIGRAQQDDGYLNTYFTIREPENRFTNLCECHEMYCAGHMMEAAAAYYKATGKDKLL
KIMCRMADLIDQNFGPEENKRHGYPGHEEIELALVKMYEVTGEERYLKLAKYFIDERGKK
PYYFDIEFEKRNRASHFSYLYPPYGMYSNGPKYEQYHLPVREQKTFEGHSVRCMYMASGA
VDVSRLTEDEELMDACRGLYENMVQRRMYLTGGIGSTPKAEMFTSDYDLPNDMVYGETCA
SVGMMFFTKRLLQAEQKGDYADTMERALLNTCLAGMSLDGKSFFYVNPLEVDPVISRDNP
DRAHVLPVRPAWFGCACCPPNLSRMITSLPEYMYTICGNEVYVNLYLSNQAKLALENMEI
QLDVKTEYPYEGEIAFEVKTEGEYGICLRIPSWSSRKWRVTINGKQAAEAGRPDNTYILK
DGFLHLMRTWKPGDHILLELDFEPKRIYANPRVSKDVGRVAIQCGPLVYCLEEVDNGKGL
QRIYLPKNAKLELVRRPDKLEGINEIHASGFRLKDFKEEDVLYMADTRWEYEPVKLVWIP
YYAWANRGENEMTVWIHEK

Enzyme Prediction     

No EC number prediction in MGYG000001873_00069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	14	590	8.8e-215	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	14	679	12	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	2.76e-163	13	590	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG4225	YesR	6.55e-04	168	231	46	105	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG1331	YyaL	0.003	163	319	415	563	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	0.004	169	231	603	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB41651.1	1.07e-232	11	678	8	645
ADQ06238.1	3.37e-231	10	678	15	654
ADH61394.1	3.62e-231	11	679	14	648
AGB18348.1	4.27e-227	11	679	10	647
ADL68222.1	4.19e-226	11	679	36	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	6.25e-218	12	679	14	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.96e-211	12	679	14	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	7.00e-168	13	674	2	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	9.91e-168	13	674	2	654	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	2.80e-167	13	674	2	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.84e-167	13	674	2	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001873_00069.