CAZyme Information: MGYG000001871_02090

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae
• CAZyme ID: MGYG000001871_02090
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000001871_13|CGC1	35364.16	8.6879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001871	2601956	MAG	Denmark	Europe

• Gene Location: Start: 30742; End: 31677 Strand: -

Full Sequence      

MAADSKEPFITRVKVALRMLLYRWQYARLKKPVAAVSVLDSVATVKLILEKRCSVCRYGD
GEMDMITSLKDGYNDTRKSDFQKYDKKLALRLKDILKTGSDEAANLLVCIPYVWKKPQLL
MAKPQLFVKRSFVNNQAVIFESINLASVYGDSYFTRFYMDCKDKDKGEYIKYVKQIWNGR
QLCIIEGEQSRLGVGNDLFGNAASIERILCPALNAFEKYDKILEAALKVDKSRLVLIALG
QTATVLACDMARAGYQAIDIGHIDIEYEWFLMGATEKVPVKHKYVNEVPEGRQFTDETDA
AYLSQIIDVVK

Enzyme Prediction     

No EC number prediction in MGYG000001871_02090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	55	287	7.5e-85	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	5.79e-119	38	307	1	261	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
pfam08759	GT-D	5.89e-107	56	288	1	223	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW87124.1	1.22e-132	13	311	12	311
AAO75156.1	1.22e-132	13	311	12	311
AJW64740.1	3.46e-73	10	307	2	302
QWI12255.1	1.00e-67	25	307	22	295
ABY44566.1	5.64e-67	25	307	22	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PHR_A	9.69e-61	29	307	5	273	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PFX_A	1.37e-60	25	307	2	273	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHS_A	1.09e-59	29	307	5	273	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	1.39e-56	36	307	6	268	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	1.57e-50	36	307	415	676	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	2.94e-42	29	307	541	809	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001871_02090.