CAZyme Information: MGYG000001871_02085

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae
• CAZyme ID: MGYG000001871_02085
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001871_13|CGC1	41602.16	9.0098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001871	2601956	MAG	Denmark	Europe

• Gene Location: Start: 25184; End: 26281 Strand: -

Full Sequence      

MISAVGLRQGGTLTILRDCLRYLSSAVAEKRFKVVALVHKRELVDFPGIEYIELPDVIKS
WSRRLWCEYVTMHRISRQLPEADLWLSLHDTTPRVNARRQAVYCQTSFPFYKRRLLDFYF
NYKIALFSLLTRFAYRINVHRNCYLVVQQPWFRDGLSKMLNVDKSRFIVAPPEQMPVDVV
ADKVELPCYTFFFPSAPDCHKNFEALCEAAARLESEVGKGVFKAVVTLSGKENRYTRWLY
GKWGNVDSIDFAGYMSKSRLYGYYKAADCLVFPSKVETWGLPISEFGATGKPMIVADCPY
AHGTSAGCAKVAFFDVNRPDVLESLMKKALSGDNSCFHAQPAAHVGKPEARSWQELFAML
LDSKG

Enzyme Prediction     

No EC number prediction in MGYG000001871_02085.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.08e-52	2	331	6	332	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
COG0438	RfaB	1.33e-17	20	362	21	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.42e-13	20	299	20	300	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	2.44e-11	200	336	14	148	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03817	GT4_UGDG-like	3.72e-10	201	301	214	311	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAY03604.1	6.19e-183	1	361	9	369
AAO75161.1	6.19e-183	1	361	9	369
QMW87127.1	6.19e-183	1	361	9	369
QMW85296.1	3.97e-164	1	362	9	370
AAO77971.1	3.97e-164	1	362	9	370

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37751	3.45e-55	1	326	7	333	Putative glycosyltransferase WbbK OS=Escherichia coli (strain K12) OX=83333 GN=wbbK PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001871_02085.