CAZyme Information: MGYG000001848_00851

Basic Information

• Species: Eubacterium_F sp000433735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp000433735
• CAZyme ID: MGYG000001848_00851
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000001848_3|CGC1	48700.66	5.7913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001848	2356822	MAG	Denmark	Europe

• Gene Location: Start: 18637; End: 19851 Strand: -

Full Sequence      

MERKLYKLVKKLAILYYRFLCLVLPVNQKRVVFDSSLGKSYAGNPKYIYEYLVANGYDIK
WDCIWFYEKDKYNIPGMSRQVQYGRMRYLYYMATAKIWVFDNRQPEFLIRRKDTYYIQTW
HGTPLKKLALDMEDVFMVGETDINEYKKHFAKNVQTWDYLISQNAFSSETFARAFDFHKK
MLEIGYPRNDILFRDNNEEAIKRHKKMLGLPTDKKIILYAPTWRDDEFSEDDKYEFRPKI
SFEKLQEELGDEYIMIVKYHYLIMDAVDWTPYEGFVYHFDQSRDIAELFLVADLLVTDYS
SVMFDYSILKRPMFFFAYDFYKYKNELRGFYFSYRKEMPGPISSTTEELIRDIREYDGSL
YEERYENFCRRYNGVDDGSASGQVATLMDLLIPAPCPNVYYENE

Enzyme Prediction     

No EC number prediction in MGYG000001848_00851.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.22e-112	25	384	1	354	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	2.52e-75	8	381	6	377	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ10349.1	9.30e-119	10	384	329	699
AJG93766.1	2.37e-114	16	384	337	705
ALQ70765.1	1.86e-113	16	384	337	705
QOV10415.1	3.33e-113	25	384	347	702
QHS23522.1	1.31e-112	17	384	337	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.36e-99	26	388	350	714	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.47e-98	26	388	350	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	4.08e-98	26	388	350	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	6.16e-106	3	374	353	732	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	8.98e-102	23	384	26	388	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	6.19e-99	26	388	350	714	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	3.28e-89	15	384	14	383	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKJ2	3.16e-34	23	384	252	599	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.493806	0.502014	0.002445	0.000597	0.000433	0.000680

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001848_00851.