CAZyme Information: MGYG000001832_01944

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila
• CAZyme ID: MGYG000001832_01944
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	MGYG000001832_208|CGC1	23908.27	10.6796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001832	3017752	MAG	Denmark	Europe

• Gene Location: Start: 2615; End: 3256 Strand: -

Full Sequence      

MFVRVMMAVFLVAQVAAGAWAADVPRAALRHRAELVRVSRSVWGLDAPVSVFAAQVHTES
WWRNDTVSPAGAQGLAQFLPSTATWLPRAVPDLEREAGPAAPFNPAWALRALVSYDKWLW
DRVEGEGGCQRMAFALSAYNGGIAWVGRDRKEAARRGYRPGRWFGHVEEVNAGRRASAFR
ENRRYVRLILLERQYWYERAGWGPTLPCGEAAR

Enzyme Prediction     

No EC number prediction in MGYG000001832_01944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	190	1.4e-16	0.7481481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.07e-20	53	190	16	153	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	4.61e-17	48	142	4	94	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.43e-12	52	190	4	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	6.77e-12	48	159	11	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	8.49e-10	34	199	6	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV72330.1	1.91e-78	17	203	8	192
CAJ53988.1	1.28e-72	23	208	21	202
AGC50703.1	1.28e-72	23	208	21	202
ABO60693.1	7.97e-71	4	204	2	199
AOJ85113.1	3.12e-70	6	204	1	198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999167	0.000142	0.000156	0.000133	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001832_01944.