CAZyme Information: MGYG000001826_00944

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000001826_00944
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	MGYG000001826_34|CGC1	56262.13	4.8248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001826	2168112	MAG	Denmark	Europe

• Gene Location: Start: 612; End: 2108 Strand: -

Full Sequence      

MGFSKDFLWGGATAANQYEGGVFEGGAGLATADVMTNGSHTVRRQVTWKKEDGTTGSTPL
CFGSDERDLPEGAVPCLLDDEKYYYPSHIASDFYHHYKEDIKLCAEEGFNCLRFSMKWSR
IFPNGDDETPNEEGLKFYEDIFDECHKYNIEPLVTLSHYETPLALAAKYNGWADRRLVDA
FVKYATTVFKRYEGKVKYYLTFNEINCIEAAPFVTAGLIHGSKQNVASAAYHQFIASAKT
VLAAHKDFPSIKVGMMLAMGPCYGLTADPEDQLLAMQRENGTLFYSDVQMLGFYPNYKLA
EYKREGITLPVQEGDMELLKAGVCDFLSFSTYGSSTVTTHPDEGAPGEGNGGSVPHQVRN
PYLKTNAWGWATDPQCLRIVLNIFYNRYHCPLWCVENGIGWNDKFEDGTVHDDYRIDYMR
ANIKSMRDAVEYDGIELMGYLYWGCVDMVSNGEGEMAKRYGQIYVDADNYGKGTFKRSLK
DSYYWYQKCIKSNGEDLD

Enzyme Prediction     

No EC number prediction in MGYG000001826_00944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	494	3.6e-131	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	497	2	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	498	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	1.71e-179	3	498	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	6.56e-178	1	498	4	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.53e-165	5	497	8	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK22868.1	1.42e-228	1	498	1	492
BBK62636.1	5.77e-228	1	498	1	492
AEN79174.1	4.04e-224	1	497	1	493
QCX34290.1	7.58e-224	2	498	3	493
AWZ38958.1	1.11e-223	1	497	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.09e-157	3	497	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.35e-156	5	497	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	5.92e-152	5	497	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.68e-151	5	497	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.53e-146	5	497	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.83e-155	5	497	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	5.27e-155	3	497	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	3.13e-151	5	497	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	5.60e-148	3	498	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	2.10e-142	1	498	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001826_00944.