CAZyme Information: MGYG000001818_01156

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; HGM12957
• CAZyme ID: MGYG000001818_01156
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		68660.6	6.7659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001818	1547538	MAG	Denmark	Europe

• Gene Location: Start: 826; End: 2646 Strand: -

Full Sequence      

MEENWSDNGLKTVHKDYTRVLAVPYDILISGNGDIVNKLRIWGAKSLDNFDMSLFSRGEY
LKSVENEAQSEAISKVLYPADDHDTGKRLRLRQQYFFVSASLKNIVKEHLAQYDTLDNLA
EKVVIHINDTHPALSIPELMRILMDEHGYSWDGAWSICTKTLAYTNHTVMSEALEQWSVA
MFKSILPRIYSIVKEINRRFCEDVYVNHPEKRACIDNIAIISRGMVKMANLCVACSFCVN
GVSALHSEILKNDLFRDYNDIFPGRLTNVTNGIVHRRWLCQSNPKLTELLCETIGDGFIK
DSMQLERFLQFRDDDSVLNRLSEIKLENKRRLAGYIGKSCGISVSPDSIFDIQAKRLHEY
KRQLLCALYILYLYRKLKSNEISITPHTFIFGAKASSGYVMAKEIIRFICAVADTVNSDT
QTNGFLKAVFLPDYRVSLAEIMMPAAELSEQISLAGKEASGTGNMKFMINGAITIGTLDG
ANVEIHEQVGDDNIFLFGMHTDEVNARRASYRPSDVLNSNSQLCDILKFVSDGGLCGKNF
DSIVHYLKDSDPYMTLADFESYKDAQLRADKTWNKMSLVNIAKAGVFSSDRAVSEYAERI
WKLRKI

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	12	603	1.8e-210	0.8531157270029673

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	20	606	211	813	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	3	605	161	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	31	605	213	798	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	2	603	177	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	2	603	180	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH55554.1	2.83e-235	1	606	185	796
QIX87764.1	4.59e-234	1	606	185	796
VEI38823.1	3.00e-232	1	606	185	796
AVQ97458.1	1.35e-230	1	603	189	803
AYF42955.1	1.35e-230	1	603	189	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7TM7_A	4.63e-174	20	605	206	804	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]
1E4O_A	4.61e-169	20	605	197	796	Phosphorylaserecognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1E4O_B Phosphorylase recognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1QM5_A Phosphorylase recognition and phosphorylysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1QM5_B Phosphorylase recognition and phosphorylysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli]
2FFR_A	1.21e-167	6	601	198	814	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
3ZCP_A	2.02e-167	6	601	210	826	Rabbitmuscle glycogen phosphorylase b in complex with N- cyclohexancarbonyl-N-beta-D-glucopyranosyl urea determined at 1.83 A resolution [Oryctolagus cuniculus]
2GJ4_A	2.33e-167	6	601	198	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39123	5.22e-180	14	604	200	795	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
P0AC86	3.13e-174	9	603	200	810	Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
P0AC87	3.13e-174	9	603	200	810	Glycogen phosphorylase OS=Shigella flexneri OX=623 GN=glgP PE=3 SV=1
Q9PKE6	4.16e-174	16	603	208	809	Glycogen phosphorylase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=glgP PE=3 SV=1
P73511	2.39e-173	20	606	228	829	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001818_01156.