CAZyme Information: MGYG000001806_01004

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_01004
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		51946.08	6.704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 26211; End: 27656 Strand: +

Full Sequence      

MKKILLLLAFIVSLAAQAAGDYDVRDFGAVGDGKTLDHGAINRAIDSCVANGGGRVVLPA
GTYLCGSIRMKSDVELHISAGATILAAPGSTEAYDESEPWEGPAYQDGGHTYFHNSLIWA
VGQQNVSITGRGMIDGKGLTKKDTEKGGNLQGGSIGTGDKAIALKECRNVLIRDITIFRG
GHFAIIMTGCDLGTVDNVTIDTNRDGFDIDCCKYLTVSNCKINTPSDDALVLKSSYALKR
PVLCEHIAVTNCVITGYKMGTLLDGTYVPEKVNWVCGRFKLGTESNGGYRNIALSNCTFM
YSSGLAFEEVDQGLMENVVVSNITMSHVHHYPIYITTGCRNRGPKERTTVSTGADIQISN
VIADDVDSLAGIIVTGMPDQPLRNIALNNIRITYRGGGTADLAKRDYREQGTNYPEPRFA
GPTPAYGLYARHVDGLDINHVTFRTERPDLRPAVMLDDVRNESIIDLKAPEVKGVKKVVK
K

Enzyme Prediction     

No EC number prediction in MGYG000001806_01004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	47	398	9.2e-60	0.9323076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.25e-57	11	448	72	498	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.01e-13	55	366	8	273	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
pfam12708	Pectate_lyase_3	2.22e-13	23	223	3	206	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
PLN02218	PLN02218	5.44e-09	24	416	70	429	polygalacturonase ADPG
PLN02793	PLN02793	1.32e-06	24	244	55	268	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28085.1	3.89e-254	1	481	1	480
SDS23558.1	3.77e-139	7	479	10	479
QEC63468.1	8.44e-137	1	473	1	468
QQR18620.1	9.20e-137	1	461	1	458
ANU56533.1	9.20e-137	1	461	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	3.61e-25	21	392	44	425	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	5.24e-24	21	300	27	320	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
4MXN_A	5.29e-23	21	253	21	236	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
2UVE_A	1.96e-14	23	144	158	279	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
2PYG_A	3.78e-08	21	87	2	68	Azotobactervinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYG_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYH_A Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii],2PYH_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15922	9.18e-11	23	227	153	396	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
A7PZL3	3.15e-10	26	392	67	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q8RY29	1.08e-08	24	416	70	429	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
Q44495	7.02e-08	21	87	2	68	Mannuronan C5-epimerase AlgE2 OS=Azotobacter vinelandii OX=354 GN=algE2 PE=1 SV=1
Q44492	7.02e-08	21	87	2	68	Mannuronan C5-epimerase AlgE5 OS=Azotobacter vinelandii OX=354 GN=algE5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998987	0.000197	0.000180	0.000177	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_01004.