CAZyme Information: MGYG000001805_00362

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000001805_00362
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001805_6|CGC3	43314.14	7.2604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001805	1812910	MAG	Denmark	Europe

• Gene Location: Start: 31186; End: 32301 Strand: +

Full Sequence      

MRKTIILAAAVLAMAFSSIASTAQTVNNFTIKRGTNISHWLSQTPERGEARRQHIKEEDF
ARLEELGFDFVRIPIDEEQFWDEQGNKLPEAWQLLTQALNWAGKHHLRTIVDMHIIRSHD
FNAVNEGRTNVLFTSDKAQQDLINMWYQLSDALKAYSVDSVAYELMNEPVADEHEQWNKL
IFKAHKALREREPQRTLVIGSNMWQATWTFKYLRIPEGDKNIVLSFHYYEPQALTHYGAP
WTPVGGYRGKLTYPGRLISQADYDAAPDSLKPVLKKYTGVWNRERIAQDFRDAIAVAKKY
GVQLYCGEWGVYEPVDRELAYKWTKDMLWVFDKYNIAWASWCYDNDFGFWDQKTQSFKDR
PLVELLTGKKK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	34	346	5.9e-150	0.9967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.80e-22	55	346	25	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.62e-13	15	348	31	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKF17200.1	4.89e-193	20	370	24	377
AGK74985.1	3.04e-191	1	366	1	372
ADB80112.1	6.07e-191	27	362	32	370
ADB80113.1	5.53e-187	1	366	1	372
ACA61171.1	2.28e-185	26	366	34	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	2.70e-37	30	370	3	342	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	7.29e-37	30	370	3	342	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	1.65e-30	28	368	9	312	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AZR_A	1.17e-29	28	368	9	312	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3AMG_A	1.17e-29	28	368	9	312	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	2.01e-37	30	370	3	342	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	2.01e-37	30	370	3	342	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	2.87e-36	30	370	3	342	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	3.58e-33	31	337	7	287	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	3.64e-11	31	347	310	637	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.998812	0.000194	0.000228	0.000205	0.000180

TMHMM  Annotations     

start	end
5	27