CAZyme Information: MGYG000001797_03216

Basic Information

• Species: CAG-590 sp900548855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900548855
• CAZyme ID: MGYG000001797_03216
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42517.79	4.6227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001797	3663255	MAG	Denmark	Europe

• Gene Location: Start: 1969; End: 3099 Strand: -

Full Sequence      

MIDLEVTEERLRKKDITLTAAPVLTGLGEKYQADQRKWQGIPSIEISPGGRLWAAFYTGG
ADEGKDNFVLLKKSDDYGKTWSDPIAAVDPPDEVRAFDQCLWFDPDGRLWLFWAQSLGGF
DGRAGVFGAFCQDHEDKAEQWSAPVRIGDGVMLNKPIVCSDGEWLFPVALWKRFPSAFNP
DQPRALSNVYSSSDHGKTFQYKGGIAIPGRYYDESVLVEKKNGLLWMLVRCEDGVGQAFS
KDGGKTWENPGKSDIPGPNSRFQVMRLRSGNLLMVNHQPENGLYRPNPDEEFFYIRSQLT
AYLSCDDGKTWSKQLLLDERDGVSYPDVAQDDNGDIYIIYDYNRYKDMEILMAVIRETED
NGLEAKQLKVVVDKPH

Enzyme Prediction     

No EC number prediction in MGYG000001797_03216.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	40	349	6.6e-40	0.9210526315789473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	9.33e-60	41	347	16	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.99e-38	50	338	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG3507	XynB2	8.50e-05	50	140	101	187	Beta-xylosidase [Carbohydrate transport and metabolism].
COG4692	COG4692	9.97e-05	48	344	42	363	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam04616	Glyco_hydro_43	4.58e-04	45	115	71	133	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU15387.1	1.41e-113	8	374	24	387
QDV18612.1	2.34e-113	13	359	31	370
QDT97307.1	6.24e-113	8	359	27	371
QEG17440.1	8.02e-113	8	374	24	387
QDT79764.1	1.14e-112	8	374	24	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	3.79e-06	135	341	299	504	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001797_03216.