CAZyme Information: MGYG000001787_01077

Basic Information

• Species: Phocaeicola sp900551645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551645
• CAZyme ID: MGYG000001787_01077
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000001787_23|CGC1	43563.94	5.9743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001787	3320861	MAG	Denmark	Europe

• Gene Location: Start: 665; End: 1822 Strand: -

Full Sequence      

MEQRIRTVVIGAGYRGKYLLRLLQAIPAYEILAVADPEPAAPEDFSCPLYAQGVFDYRRM
IAECRPELVFIASPWRFHVEQGLYALQQGCHIALEIRGGLVQDEYRPLLEESQKRHLCVY
PLENTLFLRENMAIARLVHAGVLGELIAMRGGYRHDLRDMLVDSSGGIGNPDKPEGIWRS
QFYLTENGDLYPTHGLAPLCLAAGVPKTDPITELTAFASRACGLNAFVRQRGGEGTYDVT
MGDIVITQMRTRKGILITLTHDTTLPRPRSLDFELQGTRGIWQGEHRRIYIEGRSPHEVW
EDDEAYIAEYEAPCWKEWGKEALRCDAHHQGMDYIMLQQVVADRSGKEVYPVGLEDLMLW
TSVTLYSKQSIAERRTLLLSAAKVL

Enzyme Prediction     

No EC number prediction in MGYG000001787_01077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	375	9.7e-98	0.949874686716792

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.53e-15	3	381	2	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.25e-11	5	95	1	92	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1086	FlaA1	0.001	2	74	114	186	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC [Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24037.1	8.84e-187	5	379	4	378
ADV42950.1	1.07e-160	5	376	10	381
QUT33801.1	1.55e-156	4	376	3	375
QQA30653.1	1.55e-156	4	376	3	375
QUT62197.1	1.55e-156	4	376	3	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	8.64e-69	3	373	19	416	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.05e-37	4	373	42	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	4.73e-68	3	373	19	416	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	6.63e-67	3	372	32	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	6.73e-57	5	372	53	443	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	5.13e-55	2	372	47	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4FN60	2.61e-52	2	371	58	429	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001787_01077.