CAZyme Information: MGYG000001780_03215

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_03215
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000001780_24|CGC2	91020.53	5.9015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 59391; End: 61826 Strand: +

Full Sequence      

MKKRIQFLFGSIALLGMSACSEPYVQPDAPIKEVPFTQVHLNDNFWTPRIETNRTVSIPS
AFKECEKNGRFDNFAIAGGLMKGEHRGDFSFDDTDPYKIIEGASYSLAVKYDKALDAYLD
SVISLIAAAQEPDGYLTTCVTNKCYRLSGWWGKNRWEKINSHELYNSGHLYEAAVAHYRA
TGKRSLLDVAIKNADLVCQVFGPDEGQKHVPSGHPIAEMALAKLYKVTGDEKYLKMAKYF
VEETGRGTDGHRLSEYSQDHKPILQQDEIVGHAVRAGYLYSGVADVAALTQDTAYFNALS
RIWENMASKKLFITGGIGSRPQGEGFGPNYELNNHTAYCETCAAIANVYWNHRMFLATGN
AKYADVLERALYNGVISGVSLSGDKFFYDNPLESMGQHERQHWFGCACCPGNVTRFMASV
PYYMYATQGNDIYVNLYIQSKADLNTDSNNIALEQTTEYPWEGTVSILVTPEKEQEFALR
FRIPGWAQDAPVPTDLYSFTDKAGAYSISVNGKKVNAKQYDGYATISRTWKAGDVVEISL
PMDVRRIKANDNVEDDRGKLAIERGPIMFCLEGKDQADSTVFNKFIPDATPMEAAYDANL
LKGVVVLTGNAKEVGKDGSVKEVPFKAIPYSTWNNRGADQMAVWIPEAAEYARPISEPTI
ASKARTLMIQAPIQKDAPESASVESWAWGVNDQWEPKRSSDISKPYHYWWLRNGTLETLA
YQFDQPYTVSNVQVYWLDFDHYDGNFRVPESWKLYYKDGKTWKEVEALNDYVVKKDCYNS
LDFKPVKTTGLKIAAQLQKGASGGVIEWKVN

Enzyme Prediction     

No EC number prediction in MGYG000001780_03215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	39	570	8e-214	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	38	570	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.05e-179	25	647	3	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	0.007	178	374	99	321	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04791	LanC_SerThrkinase	0.009	176	237	154	227	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71484.1	0.0	1	811	1	811
ALJ59245.1	0.0	1	811	10	820
QUT89696.1	0.0	1	811	10	820
AND19021.1	0.0	1	811	1	811
QQY38942.1	0.0	1	811	1	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	6.27e-218	30	646	6	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.42e-156	37	647	14	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.67e-152	37	647	14	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.90e-110	4	648	5	697	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	9.56e-106	73	644	56	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.23e-105	73	644	56	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000028	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_03215.