CAZyme Information: MGYG000001780_03121

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_03121
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001780_23|CGC1	43293.34	7.9033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 23493; End: 24629 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASHLMAALKVEDPQAEFRFFGGDLMAAVGGTMVKHYKELAYMGFI
PVLLHLRTIFANMKRCKEDIVAWQPDVVILVDYPGFNLNIAKYLHARTQIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVEFFEGKHHYPIHYVGNPTVDEVAAFCAKHFETRD
DFIFENKLESKPIIALLAGSRKQEIKDNLPDMLRAASAFPEYQLVLAGAPGISPDYYREY
MGDAKVKILFGKTYHLLQQAEAALVTSGTATLEAALFRVPQAVCYHTPIGKVISFLRRHI
LTVKYISLVNLIANREVVKELVADTMTVEQVRAELERILYNKEYRQQMLDGYEYMASRLG
DAGAPRHAAQEMVRLLRK

Enzyme Prediction     

No EC number prediction in MGYG000001780_03121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	1e-113	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.34e-107	1	378	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.13e-94	1	378	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.43e-71	4	371	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.30e-60	5	375	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.22e-47	1	329	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61154.1	2.67e-257	1	376	1	376
QUT93317.1	3.11e-256	1	376	1	376
QDO69124.1	1.68e-254	1	378	1	378
QPH59250.1	1.13e-239	1	378	1	378
QMI80442.1	4.59e-239	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.52e-35	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	9.39e-35	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.42e-65	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	6.70e-60	5	369	14	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B3E4H8	3.41e-59	2	369	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	7.90e-57	5	378	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
C1F718	1.70e-56	4	364	8	376	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_03121.