CAZyme Information: MGYG000001780_02927

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_02927
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001780_20|CGC2	43250.75	8.5502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 60833; End: 61954 Strand: +

Full Sequence      

MRKLIIVGLMTFVPIWLSAQKAFKNWPEGASPKAVGELVSKRFVEVPHPNFNGNPAPPNE
ITYPETCAWFGALRYADITHNKKLLRQLEERFLPIFGPERRLQPLPDHVDHTVFGTIPLQ
LYAQTGKEIYYHMGIWYADEQWKMPRNTKHKEEYQALLDKGLSWQTRYWIDDMFMISAIQ
SQAFFVTKDRRYIDRAAAEMVVYLDKIQRPNGLFYHAEDVPFFWGRGNGWMAAGMTELLG
LLPEDNPNRTRILESYRKMMDTLRKYQKEDGLWGQLVDDKTTWTETSGSAMFIYAMIKGV
KQGWLDEAVYTPIVRKAWIALVGHIDEKGDIAGVCEGTNKTNDRQFYLNRRTLSGNMHGQ
APVLWCVNAFLEK

Enzyme Prediction     

No EC number prediction in MGYG000001780_02927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	368	7.2e-74	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.22e-51	63	364	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.52e-49	41	366	11	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59941.1	1.56e-277	1	373	1	373
QUT89045.1	1.82e-276	1	373	1	373
QIH32537.1	5.99e-169	5	373	4	374
QQT56290.1	5.64e-168	5	373	8	378
QQT33758.1	2.29e-167	5	373	8	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	8.06e-33	169	365	200	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	7.05e-23	57	359	35	353	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.99e-22	57	359	25	343	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	4.35e-21	153	318	145	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
3QWT_A	5.85e-19	192	373	190	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.86e-22	57	359	35	353	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	1.45e-19	169	347	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	1.17e-16	137	334	139	343	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.59e-16	152	334	140	342	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P0A3U6	1.32e-10	221	364	61	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.350104	0.641730	0.006844	0.000614	0.000314	0.000378

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_02927.