CAZyme Information: MGYG000001777_01859

Basic Information

• Species: Eubacterium_F sp000434115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp000434115
• CAZyme ID: MGYG000001777_01859
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000001777_39|CGC1	44609.36	4.7704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001777	2510144	MAG	Denmark	Europe

• Gene Location: Start: 2526; End: 3713 Strand: +

Full Sequence      

MRLRKWSIGVCAALGLALCLTGCGQSEQKETKNQPTTAAVTASAVTDSKSDAKTLKEAFD
GDFKVGVTTTSGYLSEADRVAQIKENFNSITMENEMKPESLLDWEGSEKSKDGMPAIKEE
TLEKALKAAREVGIPLRGHTLVWYSQTPKWFFSKKYDPSKGYVDKATMKKRMESYIKQVL
TYCKENYPGVVYAWDVVNEAVGDDGNYRTESMWYETYGDFSYIKDAFTFARKYAEEGTKL
FLNDYNEYIAQKRDLLYAKVVELHDAGILDGVGMQSHWDMEVPSVDLFETALEKYASIDG
IEIQLTEIDMHNTDDSEEGLKKQAERYKEFFDVVTKMKREGKANITCVTFWGLKDGESWL
SGVKGETSYPLLFTDDMEKKPCYESILEAGKTGGK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	55	389	1.7e-92	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.91e-101	55	388	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	9.43e-91	96	386	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.66e-70	72	388	45	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA43712.1	6.90e-85	55	389	3	337
ADL33823.1	1.33e-83	55	389	3	337
CUH92237.1	9.22e-82	44	387	252	600
BCS82260.1	2.91e-81	24	390	45	417
AZT91389.1	9.08e-80	24	390	45	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OFJ_A	6.36e-67	55	389	11	338	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
2W5F_A	2.39e-66	55	386	184	524	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
5OFK_A	4.98e-66	55	389	11	338	Crystalstructure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose [Caldicellulosiruptor bescii DSM 6725],5OFL_A Crystal structure of CbXyn10C variant E140Q/E248Q complexed with cellohexaose [Caldicellulosiruptor bescii DSM 6725]
6D5C_A	7.48e-65	55	389	23	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
2WYS_A	3.95e-63	55	386	184	524	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	1.38e-85	55	389	3	337	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	1.05e-73	96	390	1	302	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
P29126	3.64e-64	48	391	623	954	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
P51584	1.39e-63	55	386	195	535	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10474	4.11e-60	55	389	45	372	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001777_01859.