CAZyme Information: MGYG000001775_00767

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum
• CAZyme ID: MGYG000001775_00767
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001775_15|CGC1	38017.64	4.4943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001775	2417274	MAG	Denmark	Europe

• Gene Location: Start: 32843; End: 33862 Strand: +

Full Sequence      

MKGLKSILFAAAAMITAPAVITSCDDWTEPEAKDYYTPPTPGYENNLKDYFKSPHKVMFG
WFGSWTGSGKANSLVGLPDSTDFVSLWLTWGPLTPAQQTDLKAFQARGSRAVLCWLATNI
GENITPGYSGVPPIEAAQEFWGFTNGDIPSMIEAAKKYADAIADTCDKYNVDGFDMDIES
HGTLIYGSGTEQRKVQNEFLRQLRKRFDESGRMLVIDIPGGTGWLSYYDELDDDVVESVD
YICWQTYELNHAGLDNFFDAVKRYKPELFEKVLAKSIITATFERAADKYLFPIQSTWEYK
DGLPHAGQGAYHIEYDYPGTPDYPYIRKGIATQNPPINN

Enzyme Prediction     

No EC number prediction in MGYG000001775_00767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	148	264	9.8e-16	0.375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	5.93e-48	56	328	1	255	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam16141	DUF4849	1.03e-39	28	330	1	316	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
pfam00704	Glyco_hydro_18	2.62e-09	153	257	87	184	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	2.38e-08	141	250	74	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
smart00636	Glyco_18	7.97e-05	156	257	93	193	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB36982.1	8.25e-226	1	339	1	338
ANU62530.1	8.25e-226	1	339	1	338
QQR10140.1	8.25e-226	1	339	1	338
QMW88054.1	8.34e-145	23	339	27	340
ALJ42193.1	8.34e-145	23	339	27	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	3.06e-43	21	334	16	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	3.42e-08	47	264	21	215	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001775_00767.