CAZyme Information: MGYG000001773_01093

Basic Information

• Species: CAG-475 sp900550855
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-475; CAG-475 sp900550855
• CAZyme ID: MGYG000001773_01093
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000001773_89|CGC1	34574.27	4.6882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001773	1468458	MAG	Denmark	Europe

• Gene Location: Start: 3139; End: 4062 Strand: -

Full Sequence      

MNKKTFLKTIILILTLCVACCALFACNEKPDDTPEPTPTPTPEPEPPKFYEAKEGYEYGE
DVEITYHSQVTNDLKHAYVTLPANYDESKKYPVLYLLHGMACTHKSWLEMCNAKYVVQNL
VIEENVKEMIIVSVNSIVTEGEIPPSTFSEDYCTAFDKTGEDIITSLMPYVNEHYSTLTD
RKNTAIAGFSMGGRETLLTAFAYQDYFNYVGAFSPSGFGKKAVSFDTTVPDFKYKDGKSF
DVVMLAIGNVDTMTSLFYPAIDQKLTQNGIEHLSKKYQGGHDQSVWRAALFDFVQLIFTE
NQQKSVI

Enzyme Prediction     

No EC number prediction in MGYG000001773_01093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	69	295	1.8e-42	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.84e-28	56	298	64	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.70e-19	68	292	1	241	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	5.16e-13	68	302	16	263	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG0627	FrmB	6.29e-10	78	215	41	185	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG1506	DAP2	1.91e-05	76	212	379	502	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL52399.1	1.79e-38	53	298	72	322
AEJ20917.1	1.98e-37	59	298	36	267
ADZ84563.1	7.78e-36	54	298	223	472
ADZ47894.1	9.79e-36	48	298	13	270
QEH70018.1	1.08e-35	54	298	223	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXU_A	3.57e-37	48	298	13	270	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]
1JJF_A	1.14e-30	51	296	22	256	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	3.10e-30	51	296	22	256	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	6.31e-22	58	298	136	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	1.31e-20	49	298	106	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	4.84e-28	51	296	41	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	4.18e-17	49	298	419	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.36e-16	47	298	129	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	1.64e-14	49	298	488	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000081	0.999963	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001773_01093.