CAZyme Information: MGYG000001763_01217

Basic Information

• Species: Prevotella sp000434975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000434975
• CAZyme ID: MGYG000001763_01217
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000001763_24|CGC1	61672.48	6.8338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001763	2771387	MAG	Denmark	Europe

• Gene Location: Start: 33223; End: 34881 Strand: +

Full Sequence      

MNKSVILSMAFAAVMSFCSLAANAQSLSPSTKWHWNKGKIMIESPERPAGQKDVLGLALP
KMKTVRVGFVGLGMRGPSAVEDFCLIPGVEIVALCDYVEARAAKQNETLRKHGLAPAAVY
YGEKGYEDLCRRNDIDLVYIATDWEHHAVVAKCAMENGKNVADEVPSAMNLEECWQLIDL
AEQKQLNCMILENCCYDWFEMRTLNMAQHGVFGEILHAQGAYIHNLDEFWDYYWKNPNGS
DPEQLGWRLKYNRENRGDIYATHGLGPVAQLLDIHRGDRMATLVAMDTKSVHGKELVEAK
TGKPCDDFRNGDHTTTLIRTANKKVIELQHDVMNPQPYNRLYQLTGSRGFANKYPVEGYA
LDSKQLAASGVQPQVDNLSTHSFMPEAEKQALEAKYDHPILKKFGKLAKEVGGHGGMDFI
MTARLVYCLQNGLPLDMDVYDLAEWCSIAELGALSMDNDCAPVAFPDFTRGLWNKFKGYR
HAYATPEEEAQTEAAANKFTKAYKEATAKLKLWTLYDNVQNAKTDAAKKKAQTQLDKAVV
KAKNHAAKLCAL

Enzyme Prediction     

No EC number prediction in MGYG000001763_01217.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	61	475	4.7e-151	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.26e-20	62	362	1	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.37e-11	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ31109.1	3.29e-283	3	509	2	509
QFQ13386.1	9.80e-281	9	520	1	519
QPH58140.1	3.29e-272	3	509	5	507
ADY37128.1	3.81e-272	22	509	24	508
QUT62233.1	4.66e-272	3	509	5	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.91e-86	47	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	6.43e-70	63	477	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	7.67e-07	64	222	7	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	1.19e-06	98	239	32	173	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	8.69e-06	62	227	3	161	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	5.59e-269	3	509	5	509	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	5.83e-263	14	509	15	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	2.20e-249	24	548	21	542	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	2.16e-196	42	484	38	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q5LGZ0	1.28e-193	18	484	17	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000506	0.992941	0.005804	0.000285	0.000241	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001763_01217.