CAZyme Information: MGYG000001763_00920

Basic Information

• Species: Prevotella sp000434975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000434975
• CAZyme ID: MGYG000001763_00920
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001763_16|CGC1	40131.42	6.309

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001763	2771387	MAG	Denmark	Europe

• Gene Location: Start: 9828; End: 10886 Strand: -

Full Sequence      

MKKSILSAMALAFAFAMPAAAQDGLLKKYDRRLTTPRNYVCYRTTEKMKIDGKLNEKVWQ
KAAQTESFVDISGFDFPKPIYDTKARLLWDDEYLYISAVLEEPNIVANLTQRDTIIYHDN
DFEVFLDPTGDGQNYFEIENNARGVIFDLMLDRAYRSGGNFHIQWDCPGLKLAVQHDGTL
NKQKDTDRSWTVEMAIPHKAVTRNFANPLKAGNIWRLNFSRVQWLKKGGPEENWVWTPTG
EINMHAPNQWGFLQFSDKVAGNGTDEFQCPYNMEAYKVLWALFYAQLDQHGKDGRYTSSL
DVLGLTDADLATLPKGSNIEMEATTHQFRASILVGGTGKRYVVDHNGKFEVL

Enzyme Prediction     

No EC number prediction in MGYG000001763_00920.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	50	253	1.5e-41	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	1.56e-76	50	252	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	1.27e-30	39	222	2	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
pfam06452	CBM9_1	8.74e-12	50	251	1	177	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd00241	DOMON_like	1.73e-05	82	197	19	123	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	8.67e-04	50	197	4	137	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH07622.1	1.28e-156	13	349	19	354
QCT78438.1	1.28e-156	13	349	19	354
QRP90424.1	1.81e-156	13	349	19	354
AKA51642.1	1.81e-156	13	349	19	354
QCQ41457.1	5.13e-156	11	349	17	354

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69230	3.18e-06	50	148	909	998	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999140	0.000155	0.000151	0.000145	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001763_00920.