CAZyme Information: MGYG000001761_00447

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000001761_00447
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000001761_26|CGC1	86458.44	4.7068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001761	2495136	MAG	Finland	Europe

• Gene Location: Start: 9978; End: 12422 Strand: +

Full Sequence      

MQSAHSYSGSLQAAPSPREKRHAALARKAAAAGIVLLRNDNVLPLDPDISVALLGTGAGR
TVKGGIGSGDVNNRANVSIYEGLRTAGIHLTSEDWINYYEALYHGARLAWKDKILDDATK
VENPFDAYAANPFVLPLGRPVTLQDLVGASVAIYVISRISGEGKDRTPTAGDYLLSERET
ADLRTLNEAGLPLVLVLNAGGPVELTDLLAEYRHPLAVLQISQPGQQGGEAVADILLGKA
VPEGKLTATWAKRYADYPCADTFGACNGDLEKEDYAEGLYVGYRWFDSFGIEPLFGFGHG
LSYTTFSTAFTALRPGDHGVEVDLTVTNTGDRFTGREVAQLYAACPQTGTAREYRRLAGF
SKTRPLAPGESQTVTVAVPAKQLAEFLPGRGAWVIPAGIYTLFAGGSLAEAAPCAHLTVD
AEVVLETTHPICPLHHPFGEVGSAAPAMEKAAKAAALDLPAFVFAPLSDEVPVPAPVPMA
DGPVDELVPMLYGNITQGASTLGSAGIRVPGSAGETSEALEASRGVPSLIMADGPAGLRL
RQSYQVDPADGSVIPTGVLGSLENGFLDEPRHLDTADTYYQFCTAFPVGTALAQSWDSDL
MEEFGRAIAAEMAEFHIDLWLAPGMNIHRNPLCGRNFEYYAEDPLLSGLLAAAVTRGVQA
DGTRGVTIKHFACNNQEDHRMGVDARVSEQALREIYLRGFEIAVKTAAPAALMTSYNRIN
GVQAANSYDLCTVAARGEWGFDGLIMSDWNTTVPADGSEPWRCAAAGNDVIMPGNPHDDA
DIRAALADGRLAETDVRACAGRLIALARRLTNGR

Enzyme Prediction     

No EC number prediction in MGYG000001761_00447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	522	773	2e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.24e-46	584	810	81	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.64e-35	34	283	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	7.11e-26	505	806	33	316	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	1.72e-23	33	405	394	751	beta-glucosidase BglX.
PLN03080	PLN03080	1.97e-19	584	748	112	297	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30269.1	0.0	7	811	7	813
CBL20304.1	1.32e-314	7	811	8	817
QCO92985.1	1.52e-313	7	811	8	817
AEN96286.1	6.54e-311	7	810	21	797
QBE97876.1	1.26e-234	7	799	8	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	3.15e-104	27	800	41	812	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	3.01e-63	17	407	319	701	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	3.01e-63	17	407	319	701	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.96e-46	523	791	34	269	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	3.92e-45	525	804	36	283	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	1.08e-100	31	804	18	759	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	1.54e-95	20	772	26	788	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
E7CY69	2.56e-46	523	789	34	267	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.56e-46	523	791	34	269	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P14002	2.15e-44	525	804	36	283	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999264	0.000784	0.000001	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001761_00447.