CAZyme Information: MGYG000001757_01294

Basic Information

• Species: Ruminococcus sp900540005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900540005
• CAZyme ID: MGYG000001757_01294
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000001757_30|CGC1	40802.93	7.294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001757	2373085	MAG	Sweden	Europe

• Gene Location: Start: 22487; End: 23563 Strand: -

Full Sequence      

MRIIQILTTMSFGDAIGNDAIALKGAISDMGFQTDIYAENIDKRLPNGTAQKIEKLRRVN
RDDIILYHKSTGTDLTFKIGDYDCRRVMIYHNITPPEFFRPYSPTAAALTEYGYEGVEYL
RDKVEYVMADSAYNKSELVKMGYKCPIDVRPILIRFKDYEQTPDENIMRIFGDGRQNLIF
VGRIAPNKKQENVIRAFFCYKKLVPDARLILVGSYLGMENYYERLVRYASALGLGNDVIF
TGHIKFSEILAYYRTASAFVCMSEHEGFCVPLAEAMFFRVPIIAYDTSAISDTLGGSGVL
LDSNAPVFAAQVIHRVMTDEKLRSAVIEGQTKRLADFSYENIRDIFEKQLRNFIGKDR

Enzyme Prediction     

No EC number prediction in MGYG000001757_01294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	174	325	4.6e-32	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	6.10e-37	51	344	72	358	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	4.27e-34	52	351	73	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.63e-30	44	356	66	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	3.73e-30	178	333	5	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03798	GT4_WlbH-like	5.36e-24	127	352	154	375	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP37264.1	5.37e-136	1	354	1	354
ASN97925.1	5.37e-136	1	354	1	354
QIX91413.1	5.81e-133	1	354	1	354
QTE73647.1	4.15e-123	1	342	1	344
QTE72662.1	4.15e-123	1	342	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I45_A	1.12e-10	163	350	13	213	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]
6ZJ4_AAA	4.03e-08	146	329	182	370	ChainAAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis],6ZJ7_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis 768-20],6ZJH_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis 768-20],6ZMZ_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis],6ZN1_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU62	8.04e-15	63	316	105	355	Low-salt glycan biosynthesis hexosyltransferase Agl9 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl9 PE=3 SV=1
Q47KS6	2.41e-09	178	344	241	414	D-inositol 3-phosphate glycosyltransferase OS=Thermobifida fusca (strain YX) OX=269800 GN=mshA PE=3 SV=1
D1BD84	4.16e-09	175	348	236	416	D-inositol 3-phosphate glycosyltransferase OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) OX=446469 GN=mshA PE=3 SV=1
A0QRG8	6.53e-09	164	302	191	317	GDP-mannose-dependent alpha-mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mgtA PE=3 SV=1
Q4JAK2	8.03e-09	123	342	133	340	Archaeal glycosylation protein 16 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=agl16 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998336	0.001706	0.000007	0.000003	0.000002	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001757_01294.