CAZyme Information: MGYG000001750_01943

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_01943
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	MGYG000001750_52|CGC1	47507.09	6.3088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 4711; End: 5964 Strand: +

Full Sequence      

MKTLFLSVCLFMASLTAGAQTRYSQEMADSQGKQWTHGKNWDYVNGLVAKSLLNLCEQYQ
YADWTTRYYEWAKAYADNAINPDGTFKNFKKGNIDNINSGKVLFALYKHEKALDEKNGTH
NADRYKKAADYLHNYLVNEYSRIQNGDAKGCFFHKDIYPNQMWLDGLYMGAAFYAEWQGE
FDPDNAGAWSDIANQFKSVNRHTYDKDKQLNYHAWSYDPDDANSFWANKTEPFKGCSKEF
WGRAMGWYFAALVDVLENMPQSHPDYAELKQITLQVAKGLERWQDKESGTWYQLLQYDDS
YKSKCGIANYLESSASSMFTYAYLKGIRLGILPDSFAGVAEKAYQGLLKTFVTKNEDGTI
NLNQSCRSAGLGPAKDPSRDGSADYYLCGKDVTIVNNEGKAIGPFIMASLEYELKNK

Enzyme Prediction     

No EC number prediction in MGYG000001750_01943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	33	413	2.7e-101	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.67e-76	23	413	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.26e-72	19	414	7	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37243.1	5.17e-273	1	414	1	414
QRQ48843.1	1.89e-133	22	417	44	450
QUT45332.1	1.08e-132	22	417	44	450
BBE19946.1	1.38e-89	26	415	35	396
QCK16975.1	2.43e-87	41	413	23	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.06e-77	22	413	3	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.30e-57	14	413	7	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.36e-56	41	413	29	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.29e-10	205	356	207	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.26e-08	205	356	208	338	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.26e-56	14	413	7	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.53e-23	220	411	46	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.53e-23	220	411	46	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	5.93e-10	240	389	265	399	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.998851	0.000230	0.000172	0.000156	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_01943.