CAZyme Information: MGYG000001750_01871

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_01871
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	MGYG000001750_47|CGC1	91757.1	6.4682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 17406; End: 19817 Strand: +

Full Sequence      

MNKTITCFIPYKGETQQNKTIEDLLACPCVKDVYLLTQPGNTPTAPPQGCKSLPVGSLTS
TATFRKIASLTQTPGLLVYTKLQTLNLGYMALERMTDYLSAPECGMVYSDHYQLIEEKQQ
PHPVTDYQPGSVRDDFDFGSVILFRTEAFRKALDTIGTEPDYEFSALYAVRLALSESFRL
THIREYLYTEIEEDVRKSGEKQFDYVNPRNREVQIEREAVFTHYLKRIGAYLTPAKKIID
ITEGNFDNEASVIIPVRNRVRTIEDAIKSVLEQETDFPFNLIIIDNHSDDGTTEIIDRYK
SDSKVIHIIPQRKDLGIGGCWNLGINHPQCGRFAVQLDSDDLYSSRSTLQTIINKFHTEK
CAMVIGSYRMTDFSLNTLPPGVIDHKEWTDENGHNNALRINGLGAPRAFFTPLLRRIRVP
NTSYGEDYALGLAFSREYHIGRIYDVLYLCRRWEGNSDAALSIDKINRNNAYKDSLRTLE
ISIRQAMPKEEPAGRKFFNRQLAHWDIARNNYNALDNIQIRNMEIEGCTIEVQFNPARAV
STCAKLDKQTIEARPCFLCLNNKPAEQDVLTISLDEPFILRVNPYPILPGHLTISSEKHQ
WQTLADKTDRQLPGRLVSWLENNFEKGYALFYNGAKCGASAPDHFHFQAARKHDIPFIRQ
WNSLMETAILQEEIRTENGNTCRSYSINGYICPIHAFITDHTAETDSGLIDRYLKSLPMH
GKEPEPRYNLFAWIDEKRGFTIAYFPREKHRPACYTAEGDRQILVSPGALDMAGILVTPR
KEDFDKLTPADILQIYNEVAYKK

Enzyme Prediction     

No EC number prediction in MGYG000001750_01871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	251	374	2.5e-20	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	8.25e-70	627	800	14	181	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	2.98e-21	252	370	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	3.47e-19	251	380	1	127	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	5.36e-19	251	458	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	2.93e-17	251	454	6	188	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO26250.1	0.0	1	800	1	794
ADY35406.1	0.0	1	800	1	779
QUT58622.1	6.21e-296	1	800	1	803
ABR40252.1	6.21e-296	1	800	1	803
QQY37604.1	6.21e-296	1	800	1	803

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92IF9	2.49e-08	205	343	242	384	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q4UM29	4.31e-08	224	343	261	384	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
O32268	6.27e-07	245	370	3	125	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_01871.