CAZyme Information: MGYG000001750_01340

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_01340
• CAZy Family: GT94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001750_26|CGC1	39175.46	9.054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 17627; End: 18646 Strand: +

Full Sequence      

MIRFTIFPRLHILPGQKANPYIHDFVTSLEREGVSKVVNPPHKNPLLSLLPPKNWGDVFI
FNWFESIPDFKYGPLQSVIAICFVLLLKSNRRKIIWILHNKKPHAGGHTRLKRFLTRFMA
KKSDLILTHATEGVEMIRTHYPYAADKIHFLHHPTKNRLPESSNEMNPEYDLLIWGSISR
YKGVLEYLTYLRENPQDLKICIIGKCSPASLADEIRCIAPKNVTFICESPSFEELARYIR
HSAFVLAPYCPESVLSSGILMDSLSFGARVIGPDVGSFKDYACEKRLKVYTFHHYDEIGQ
IVAIHKTDPVSQESYRKFLEENDWKHFGDRIIELTKSIH

Enzyme Prediction     

No EC number prediction in MGYG000001750_01340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT94	76	284	1.4e-17	0.7173144876325088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.32e-09	18	248	29	276	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03822	GT4_mannosyltransferase-like	2.12e-09	24	278	42	308	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
cd16344	LMWPAP	0.003	115	149	68	102	low molecular weight protein arginine phosphatase. Low molecular weight protein arginine phosphatases are part of the low molecular weight phosphatase (LMWP) family. They share a highly conserved active site motif (V/I)CXGNTCRS. It has been shown that the conserved threonine, which in many LMWPTPs is an isoleucine, confers specificity to phosphoarginine over phosphotyrosine.
cd01635	Glycosyltransferase_GTB-type	0.006	110	281	42	225	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12554.1	2.77e-157	1	337	1	338
QUU05058.1	5.28e-108	2	338	1	334
QCT76565.1	2.13e-107	2	338	1	334
ANQ62306.1	2.13e-107	2	338	1	334
QLK81295.1	2.92e-107	2	338	1	334

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_01340.