CAZyme Information: MGYG000001750_00024

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_00024
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	MGYG000001750_1|CGC2	73448.86	5.2354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 40367; End: 42346 Strand: -

Full Sequence      

MIGLVSLLLLAGVGLFFSRGAILRHMAGLKIQSVSLRYGLNISYEELGMPSLTSVSLKGL
SVVPVGRDTLLTLRKVDVTLDLFPLLGGDISVREVMTDGLKLSFIKRHGISNYDFLFHRP
GGEPDKKDVPVTMDYNQRVDKILGMLFRLLPENGELTDFTVIGQRDSLVTSFNIPDISLK
ESHFASEIRVEEGNVSNRWKVVGSLEPGNQKLEGRILSAENGEEVILPYIGPHYNAVVKF
DSIAFSLSASRNAVYKGTVLQGLAAVSGLEVYHKALSPDIIDLDNGSLDYKINIGARSLE
LDSTSTIVFNRIDFHPYIRAEKTGRWHIKAHIHRPDFPAQDLFASLPAGLFQHVQGLEAT
GNLSYDLNLDIDFNDLQALQFSSDLYGHGFRIIDFGKGDLTRMNDEFEYTAYENDLPVRT
FAIGPSNPDFRTLDQISPLLQMAVMQSEDGSFFYHQGFYPGAVQEALAYDLQVGRFARGG
SSITMQLVKNVFLNRHKNIARKLEEALIVWLIENQHITSKERMYEVYMNIIEWGPLVYGA
CEASHFYFNKEPSELTVNEAIFLASIIPKPKHFRSVFNPDATLKENQSGYYRLIARRLAA
KGMISEEEAENIVPQVEVKGPAKELILFPDSVGLAADSLSVEGLMGLEKGLDESGKELE

Enzyme Prediction     

No EC number prediction in MGYG000001750_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	426	585	1.5e-44	0.8870056497175142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.11e-49	433	602	65	227	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	9.21e-49	422	599	7	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	1.54e-47	429	602	56	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.39e-44	429	610	77	252	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.56e-34	433	611	7	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37813.1	2.78e-276	10	626	18	635
QUT79856.1	1.08e-217	5	637	15	648
QDM09851.1	1.08e-217	5	637	15	648
QNL39495.1	6.16e-217	6	623	16	632
ALJ47276.1	1.75e-216	6	623	16	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	8.63e-27	422	613	14	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.98e-26	422	613	14	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3UDF_A	6.45e-18	435	625	46	230	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	3.82e-17	443	608	55	213	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	4.71e-16	433	581	32	178	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2SYS3	9.89e-31	420	600	56	235	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=mtgA PE=3 SV=1
Q13U46	1.84e-30	434	600	76	235	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=mtgA PE=3 SV=1
O24849	5.82e-30	425	574	52	199	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=mtgA PE=3 SV=1
Q7NS41	6.45e-30	434	599	65	223	Biosynthetic peptidoglycan transglycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtgA PE=3 SV=1
C1D8R6	1.64e-29	410	598	38	222	Biosynthetic peptidoglycan transglycosylase OS=Laribacter hongkongensis (strain HLHK9) OX=557598 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.853533	0.142493	0.001918	0.000703	0.000410	0.000954

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_00024.