CAZyme Information: MGYG000001750_00017

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_00017
• CAZy Family: GH10
• CAZyme Description: Endo-beta-1,4-xylanase Xyn10C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000001750_1|CGC1	20885.62	4.4711

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 29227; End: 29784 Strand: -

Full Sequence      

MVFLKLFINDYNLEAAYNNNAKCKALIDWIAKWESDGVTRIDGIGTQMHVSYSLNAETQK
KNEECVVQMFEMLAASGKLVKISELDMGILDENGEEMETEKVTFEQQELMADYYRFIISK
YFEIIPAAQRYGITQWSATDSPAGSGWRAGMPIGLWDLNYNRKPTYAGFADGLAGKTSSR
SQVTE

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	5	171	2e-29	0.46204620462046203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	3.32e-24	5	171	164	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	1.60e-22	5	169	124	263	Glycosyl hydrolase family 10.
COG3693	XynA	6.78e-15	5	176	188	344	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61487.1	1.21e-82	4	176	584	757
ADD61481.1	1.21e-82	4	176	584	757
QUT46089.1	2.28e-82	4	176	546	719
QRQ48288.1	2.28e-82	4	176	546	719
QCD43725.1	5.13e-80	4	177	355	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1US3_A	2.33e-15	6	175	345	515	Nativexylanase10C from Cellvibrio japonicus [Cellvibrio japonicus]
1US2_A	2.33e-15	6	175	345	515	Xylanase10C(mutant E385A) from Cellvibrio japonicus in complex with xylopentaose [Cellvibrio japonicus]
3W24_A	1.75e-11	4	171	182	325	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from Thermoanaerobacterium saccharolyticum JW/SL-YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
3W25_A	1.75e-11	4	171	182	325	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E146A mutant with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W26_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E146A mutant with xylotriose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
1I1W_A	9.89e-11	5	173	168	301	0.89AUltra high resolution structure of a Thermostable Xylanase from Thermoascus Aurantiacus [Thermoascus aurantiacus],1I1X_A 1.11 A ATOMIC RESOLUTION STRUCTURE OF A THERMOSTABLE XYLANASE FROM THERMOASCUS AURANTIACUS [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59675	1.32e-14	6	175	429	599	Endo-beta-1,4-xylanase Xyn10C OS=Cellvibrio japonicus OX=155077 GN=xyn10C PE=1 SV=2
P38535	4.16e-11	4	171	383	526	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P36917	1.04e-10	4	89	531	605	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
O94163	1.50e-09	5	173	192	327	Endo-1,4-beta-xylanase F1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xynF1 PE=1 SV=1
A1CHQ0	6.80e-09	5	166	192	310	Probable endo-1,4-beta-xylanase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=xlnC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_00017.