CAZyme Information: MGYG000001750_00012

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_00012
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	MGYG000001750_1|CGC1	91848.3	6.3845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 21642; End: 24065 Strand: -

Full Sequence      

MFYNLINEKLMVRKRFILLASFVALFANSFAQDKLYHNEFPLGDVKLLDGPFKHAQDLNV
NVLLQYDVDRLLAPYLKQAGLPPKAESFENWIDLDGHVGGHYLSALAIHYASTGNEECKK
RMEYMISELKRCQDKNGDGYVGGAPGSKTLWNEIRKGNVGIIWKYWVPWYNVHKMYAGLR
DAWLYVGNEDAKNMFLKFCDWGMGVISSLSDEQMEQMLGNEFGGMDEVFADAYQMTGDVK
YLDTAKRFSHHWLLDSMAKRVDNLDNKHANTQVPKVVGYQRIAENSLAAGRDADAALYEG
AADFFWHTVTGNRTLAFGGNSRREHFAPADDCKSYVDDREGPESCNTNNMLKLTEGLFRM
NTDAHYADFYERALYNHILSTQHPQHGGYVYFTSARPAHYRVYSAPNSAMWCCVGTGMEN
HGKYGEFIYTHHSDSLFVNLFIASELNWKEKGMIIRQETSFPDEETVRLTVHTKKKVRAQ
LMIRHPWWCKEGKMKVLCNGKDYAAGSAPSSYIAVDRTWKDGDRIEITMPMDVTVEELPN
VPEYVAILRGPIVLSARMGTEHLDGLVADNSRWGHIAHGPLVSVFDTPLLIGTRAEIQTK
LDAMQPVPGKPMCYTVPGLFKAPYENLQLEPFFRIHDCRYMMYWLSMTPDEFADYQKAAK
EEEEQKLLLDKRTVDAIAPGEQQPEADHGMKFENSQKGNFQGENWRDARNGGYFEYEMDT
KGETGLSLMLRYWGNETGNRTFDILIDGKVLATENLAGKWNSQKMVNVTYPIPAAMLEGK
TSVKVTFKSKPESVAGGIFYIRLLKNE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	44	555	6.9e-202	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.41e-174	44	555	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.03e-112	45	562	12	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	8.25e-40	559	644	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37333.1	0.0	12	805	1	796
QCD36520.1	0.0	31	807	22	788
QUT88913.1	0.0	12	807	1	799
QDO68314.1	0.0	12	807	1	799
SCV06553.1	0.0	5	807	1	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.40e-224	31	805	19	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.04e-217	31	805	19	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	6.39e-18	102	553	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.22e-17	343	553	381	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.02e-16	102	553	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002147	0.996423	0.000533	0.000317	0.000276	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_00012.