CAZyme Information: MGYG000001750_00011

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_00011
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	MGYG000001750_1|CGC1	33016.69	6.6023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 20514; End: 21389 Strand: +

Full Sequence      

MKKPLLILALLAIVPTILSAQQPGQSRILTDTIYSEVLKAKRAYTIFLPQSFDTDKNRQY
PILYLLHGMWENNSLWANRGHVKDVMDRLTKSGEAQEMVIVTPDAGGGDPNIFQNGYFDM
PGWKYETFFFTEFMPFIEKTYRIISDKQHRAIAGLSMGGGGATSYGQRHPDKFTAVYAMS
ALMSIPAVGAAKFDDPNGKLAILTQSVIDNSCVDYVLKGDDARKNQLRSVAWFVDCGDDD
FLLDRNIEFYQAMRNNGIPCEFRVRDGAHDWEYWHSALYQCLPFVSRHMNP

Enzyme Prediction     

No EC number prediction in MGYG000001750_00011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	35	285	4.1e-57	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	1.04e-27	35	284	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.16e-26	43	290	36	313	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	3.76e-21	34	282	75	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	1.07e-09	152	278	105	223	Esterase/lipase superfamily enzyme [General function prediction only].
COG0657	Aes	1.83e-07	146	288	150	310	Acetyl esterase/lipase [Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ06889.1	2.01e-31	35	291	314	545
AEJ20917.1	3.99e-30	31	287	41	268
AEU34816.1	5.77e-29	28	287	132	371
QDW22056.1	5.90e-29	32	287	311	541
VTS04162.1	9.93e-29	35	287	68	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.60e-153	25	287	9	270	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
1JJF_A	3.39e-22	25	287	29	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
6RZN_A	4.63e-22	35	287	139	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	4.63e-22	34	180	145	296	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
4RGY_A	4.96e-22	34	285	10	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	2.53e-20	25	287	48	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	6.34e-19	34	287	437	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P23553	5.35e-13	28	287	3	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
D5EY13	1.94e-12	32	278	504	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	1.03e-11	18	213	133	342	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000376	0.998782	0.000215	0.000215	0.000201	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_00011.