CAZyme Information: MGYG000001749_01136

Basic Information

• Species: Hydrogeniiclostridium sp900752115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium sp900752115
• CAZyme ID: MGYG000001749_01136
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		88786.32	4.7797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001749	3103959	MAG	Sweden	Europe

• Gene Location: Start: 14222; End: 16636 Strand: -

Full Sequence      

MKKTNLNDGWRFRLGLPGSFEEESWREIALPHDFMLGLDTKPDAPAGPASGFYPGAAGTY
ERTLHIPAEWEGETVLVRFDGVYRNAAVSLNGSRAAFHPYGYSAFSVDLTPLVRFGCDNR
LEVTVDTTAQPSCRWYSGAGIFRGVELLHGPAQRIAPWGLSLRTEALVGEDALVLAEVTV
QNDGPRAAACRVRVALDGQDGQAADAFTTVWLKPQAESVARLRLNVPNARLWSTDHPVLY
TARASVDCGGVTDEEETRFGVRTITVDAVHGLRINGVETKLKGGCLHHVTGITGAASFRE
QDLRILRRHKEAGYNAVRCAHNPPSSGFLDVCDELGFLVVDEAFDGWAAPKQSHDYHTTF
ADWWKRDLDAMILRDRNHPSVILWSTGNEVYERAGCGDGYAWAARLAEEVRRIDPSRPVI
NALCSLWNGLSDEDNAAAAEERRRRLEEGGTLQNFDGEYTARIWADRTEAFAAPLDVVGY
NYMEDRYEADHERFPDRVICGTESVPFAIDKIWAIVKRCPHVIGDFTWTSADYLGEAGIG
CCFYHAPDDDSVAEMHLTRPYPWRAANDSDWDLCGFERPQLAYRRIVWGSQETFLAVRDP
AHFGMREDMSFWGWPIVSARWTWPGMEGRPIAVDVYSPGEEVELFLNGRSLGRSPAGEEN
RFTARFTAVYEPGVLEAVSYRAGEEISRARVETAGAPVRVALLPEETETSPDGLLFAAVE
LQDAEGRRVPWAEPLLTASAEGAASLLSFGSAQPQAVDNYTAGAFHAFEGRALAVLRAGF
TPGEAVLRVACEGLPEAECRFSVK

Enzyme Prediction     

No EC number prediction in MGYG000001749_01136.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	560	2.4e-108	0.5811170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.79e-56	1	419	10	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.89e-39	5	419	14	445	beta-D-glucuronidase; Provisional
PRK09525	lacZ	2.03e-34	58	419	122	485	beta-galactosidase.
PRK10340	ebgA	2.47e-34	57	419	110	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	7.02e-24	6	151	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG98217.1	5.70e-274	1	803	1	812
QUL57111.1	4.30e-266	1	803	1	812
QTE69359.1	2.48e-240	1	803	1	818
AHF23795.1	2.23e-239	1	804	1	834
AHF25051.1	1.65e-238	1	797	3	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	5.88e-146	1	804	5	778	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	1.51e-145	1	797	5	771	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	5.11e-113	1	794	1	792	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T9A_A	4.68e-108	4	778	30	820	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
5T98_A	6.69e-100	5	804	29	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.42e-108	2	804	43	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.05e-79	3	790	48	807	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.74e-32	3	652	53	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A7ZI91	7.18e-29	5	419	54	485	Beta-galactosidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=lacZ PE=3 SV=1
A7ZWZ1	7.18e-29	5	419	54	485	Beta-galactosidase OS=Escherichia coli O9:H4 (strain HS) OX=331112 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001749_01136.