CAZyme Information: MGYG000001748_01891

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_01891
• CAZy Family: GH94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	MGYG000001748_20|CGC1	94805.01	5.2838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 15750; End: 18227 Strand: -

Full Sequence      

MDNVNGIFGRFLMDEPAGYEINSLDMETSWEYIFQNRDILLRLDQFGPVNAQLRPPGDIL
LFKREKDDKFSKWLIWMQADEINEGQPFTNFFRPVVHGAPRQTPENLKITFKPYEADYTY
EYEGLRIRTRFFVPNRGAHIHMEFEVENNRPGPVALNITPVLAPYVNPAQLAPWDKGEWY
LKTGFGMEEEAIFWSRLLDSSSIKENRRTAILWSSRENLQGCEISLEKWMGAGDFYRPES
VFCGDLRLTPEDCGRYGEETDKNQIYGYPPVYALRYRIEIQSGSRFVFQQVLSSPDNEPG
CGLQSLERVKRPLYLFDRETREKELQDRKAFFDNLFHMRSIHTSDSFLDHYVNTWLPLQM
HWVASLDRGWPTGMRGVRDCANDFMGELYIQPKWARDMLLLLFECQKTDGWFPRQISAKG
RRGKHDLREFVDGGAFVVEFLYEYLCVTGDFDLLRENCLWLDSDRPAPIMEHAVAAVDYY
LREENIGIHGLCKIRGGDWLDAVNRAGLEGKGESVMVTGQVIMAVTFLIRIAENMDCDLY
DMELWHQKQEDFGRAIRKHAYNGEGFFNGVYTDAGQWIFSDRDPDGESRPYICANAYAIL
SGAADCEMQKSTLRVIKGLLDDAGYKLFSPPIGRAPMEKVGRSGSGDGLMGLFENAAPYN
HGSHGFFGRCLAAVGEKEELLEVLKYMLPFDMEKHPTSQAMTPPYAVVNCWQKIPLFQNR
GGMAFLTGTISMALRMVYNWMLGIKPELNGLVIDPCCSSKLGDVKVWFSVREKRLTLRIR
QNGNQLYLDGKKVSTRLQDPFTERAVYYIPYEELHSGSVLEMGCG

Enzyme Prediction     

No EC number prediction in MGYG000001748_01891.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	103	796	2.1e-85	0.6418918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	4.50e-47	232	796	486	1036	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	9.83e-31	341	745	11	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam17389	Bac_rhamnosid6H	0.003	392	576	66	226	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV43990.1	6.21e-215	8	822	14	844
ASA25832.1	7.18e-39	223	791	217	768
VCV22855.1	4.88e-38	124	790	118	752
CBL11429.1	4.88e-38	124	790	118	752
QRT50985.1	8.66e-38	124	790	118	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZLE_A	1.47e-31	223	755	217	722	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
3QDE_A	1.33e-25	185	803	168	800	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3AFJ_A	8.91e-21	119	755	127	779	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACT_A	4.66e-20	119	755	127	779	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]
2CQS_A	1.40e-19	119	755	127	779	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7S0S2	2.31e-35	223	784	224	757	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
B9K7M6	2.92e-24	121	809	110	808	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	2.16e-15	348	759	313	741	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	6.47e-15	348	756	313	738	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_01891.