CAZyme Information: MGYG000001738_02030

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_02030
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937	MGYG000001738_25|CGC1	103595.65	8.5038

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 25143; End: 27956 Strand: -

Full Sequence      

MRLSGALLTLAALGMGMAMSGQQKISSPMEDVNGVIDNTLDSLNKARTARPVPGSTRKGD
NPVLFLVGNSTMRTGTLGDGGNGQWGWGYYMPEYFDADCITVENHALGGMSSRTFYKRLW
PEVLQGVRPGDWVIIELGHNDNGPYDSGRARASIPGIGEESLAVTIKETGEPDTVYTYGE
YMRRFVREVKAKGARPILFSLTPRNAWDDKDSTRITRVNKTFGLWARQVAEAENVPFVDL
NEITASKFERFGKEKVKTMFYIDRIHTSAFGARVNAESAAEGLRGVKGLELAQYLLPVEV
DTKTGSSRKPGRPVVFTIGDSTVKNEDKDDDSMWGWGSVLHELFDTTKVSVENHAMAGRS
ARTFLDEGRWDKVYNALQPGDYVIMQFGHNDGGDINTGKARGELHGAGGESKVFRMEATG
KNQVIYTYGWYLRKFIMDAKEKGAIPIVLSHTPRNKWQDGKIESNAASFGLWARQAARQG
GAYYIDLNAISGKKYQAIGPEGTPPYFKKDHTHSSKKGARLNAASIAEGLRGTSCPLKEA
LLPVGYSYTMDANVPAYNEFDGYGYDFGTAPTKDGKPYFFSVRVPDGNYKVTVRLGDKKR
KAQTTVRAESRRLMLDDVATAKGKFEDRTFIVHKRQKGINLKDSVRINQREVGTPTWDDK
LTLEFTGHAPAVQSVTITPVTDADSVTTVYLCGNSTVVDQTKEPWASWGQIMPAYFDSSV
CVANNAESGQRASSFLDSKRYDKVLSMARPGDWVLIEFGHNDQKERGPGKGAYYNFATCL
KIFIDRARAAGLNPVFITPTARRHFDDNGKIKDTHGDYPQAMREVAAREGVPVIELNPMT
KTLYETMGTEDSKKAFVHYPANTYPGQTEPLADNTHFNPFGATQVAKCVREGLKKAAPEL
AKHLKDAPAYDPAHPDDPAAFYWPEAPFFEAEKPYGN

Enzyme Prediction     

No EC number prediction in MGYG000001738_02030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	688	893	9.3e-68	0.9952380952380953
CE12	315	530	1.4e-62	0.9904761904761905
CE12	64	283	1.5e-53	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	1.05e-77	687	893	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd01821	Rhamnogalacturan_acetylesterase_like	1.18e-74	313	530	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd01821	Rhamnogalacturan_acetylesterase_like	8.18e-72	62	283	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	4.16e-14	62	284	9	209	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	4.19e-14	66	274	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36989.1	2.92e-308	29	541	1	513
ANU56549.1	9.43e-300	10	541	12	543
QQR18604.1	9.43e-300	10	541	12	543
QNL41143.1	1.09e-298	10	541	12	543
QDO71542.1	1.98e-298	16	541	6	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	4.26e-34	315	549	3	231	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	1.98e-33	315	549	3	231	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	5.18e-51	689	904	8	223	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
Q00017	3.66e-33	315	549	20	248	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
Q5BAA2	2.76e-32	315	541	20	235	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
O31528	6.28e-24	315	542	5	214	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
P42304	6.61e-14	315	531	180	375	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998951	0.000194	0.000167	0.000163	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_02030.