CAZyme Information: MGYG000001738_02028

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_02028
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
981	MGYG000001738_25|CGC1	109272.1	5.162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 20700; End: 23645 Strand: -

Full Sequence      

MLAAALAGSVAMNAGERYNINPGWRLTIGDIAGAESPKFDDSEWKTVTLPRAHNEDEAYR
VLIDNLTDTVAWYRKHFTIPKSAKGKKVFVEFEGARQVADVYINGHHLGAHENGVMAFGF
DLTPYIKFGKENLLAVRTDNDWNYQERGTGAKFQWNNKNFNANYGGLPKNVVLHVTEPVY
QTLPLYSSFGTTGVYVYAKDIDVQGRTADICVESQVRNETSKPARVSLVTEVTDPDGNMV
ATFSSDPRTVAPGTLAVIKASDKVGGLHFWSWGYGYLYDVKTRLVVDGRDADETVTRTGF
RKTGFVDGQFRLNDRTMMVHGYAQRTSNEWPGVGMSVPAWLSDYSNREVVRSGGNVVRWM
HVAPWRQDVESCDRVGLIQAMPAGDAEKDVEGRQWEQRVGLMRDAIVYYRNNPSIIFYES
GNKAVSEPHMADMKALRDEFDPHGGRAIGSREMLDSKTSEYGGEMLYINKSGGQPLWAME
YCRDEGLRRYWDDWSYPYHKNGDGPLYRNADASAYNLNADQLAIEHIRRWFDYWQQRPGM
GDRVSSGGVKIIFSDTNTHCRGESNYRTSGVSDAMRIPKDSYFAHQVMWDGWVTPETSRT
YIIGHWNYEPGTVKPVYVVSDAPRVELLLNGEKIGREKVDYHFLHTFDSIPYAPGTLTAV
SYDEAGKKLSEHSVSTAGAPAALRLSVETSPAGMMADGADMALVQFEVVDAEGRRCPLDN
REVTFTLDGPAEWRGGIAKGEGNRILDTTLPVECGVNRALVRSLPEAGTIRLTAMAEGLP
AQSVEWRTNPVDVRGGLTAYEQKNLLRGSLERGETPATPSYINLRETVKVVSATAGCNQE
SAANSYDDNEKSEWKNDGTLRNAWITYTFAAPTTVDEADLKLTGWRRRSYPIEILSDNGT
VVWSGDTDMSLGYVNLRLEPVETSSLTIRLRGAATESEAFGQITELVEPVANDLDLFKAQ
DGDKVGGELRIIEADFLRDVK

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	737	9.8e-65	0.7845744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.32e-23	21	503	16	495	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.64e-22	71	442	67	431	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	1.26e-19	683	785	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	8.32e-16	40	422	67	448	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam16355	DUF4982	9.47e-16	611	672	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA09137.1	0.0	16	976	26	995
QUT72799.1	0.0	16	976	26	995
ALJ39996.1	0.0	16	976	26	995
AAO77786.1	0.0	16	976	26	995
QMW85119.1	0.0	16	976	26	995

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	5.27e-167	18	822	38	841	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
4YPJ_A	2.40e-65	9	783	1	802	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	9.78e-62	16	784	2	797	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	9.03e-54	8	779	18	811	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6B6L_A	6.77e-51	16	784	6	773	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	2.27e-166	18	822	29	832	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	4.01e-50	5	779	32	839	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	1.07e-41	19	783	7	732	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	1.13e-36	19	766	50	798	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.56e-25	13	640	49	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.941951	0.057670	0.000217	0.000061	0.000045	0.000079

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_02028.