CAZyme Information: MGYG000001735_03852

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_03852
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
148	MGYG000001735_83|CGC1	16952.36	7.3144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 13602; End: 14048 Strand: -

Full Sequence      

MDKQVFFKQFLPAAQAAGEHFKLNPDMILAQAAIESGWGESVLCTVYHNYFGLTGYGQPT
LYWKGAKTLKIEDGGISHLQFRIYETVEQSFFDFARLIRIVYPTAATVSYHPEAYAKEIA
YSRYISEVNGDNREAYRQLILSICKYIK

Enzyme Prediction     

No EC number prediction in MGYG000001735_03852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	12	146	7.7e-22	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.71e-18	2	124	42	165	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	7.65e-18	12	102	2	87	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	3.59e-14	1	119	150	275	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.43e-13	1	124	158	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK12710	flgJ	5.10e-11	6	143	133	272	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48008.1	7.74e-51	1	147	1	143
QUT49904.1	5.40e-50	6	148	8	146
ABR43268.1	8.61e-50	1	147	1	143
QRO16544.1	8.61e-50	1	147	1	143
AST53983.1	1.73e-49	1	147	1	143

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.55e-06	4	98	2	102	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.83e-06	4	98	3	103	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
4Q2W_A	2.88e-06	17	76	178	235	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
5DN5_A	4.83e-06	1	128	1	144	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.68e-06	1	128	1	144	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I4P4	5.18e-08	6	127	242	371	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_03852.