CAZyme Information: MGYG000001720_01393

Basic Information

• Species: Prevotella sp002350355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002350355
• CAZyme ID: MGYG000001720_01393
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000001720_21|CGC1	49241.68	9.8457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001720	3435079	MAG	Sweden	Europe

• Gene Location: Start: 30265; End: 31545 Strand: +

Full Sequence      

MITIKNKYLWMVLIALLPLLPLHAQHRIARKAKAKAATEQKAKTLNQIFKVNDYWQKNHT
PEATAFWNVAAYHTGNMEVCKWLTQELSSNKKLSAKRRKLLTDKLNAYLAYSLRWAEHNQ
WKGATEADTAKWLYKKYGEDQQHVLFGDWQICFQTYIDLYNMFQVQQGSKGQTLTKMEIS
SPDLMTARAKEVMGYVVSHSAHDYWWWADALYMVMPVMMKMYKLTGDVRYLDKLYDNICY
SDSIMLDKETGLYFRDGKYIYPMHKTNSGKKDFWARGDGWVLAGLAKVLQDMPKSYRHYD
FFLKKYQRLALAVAKIQQPEGYWTRSMMDPQQAPGPETSGTAFFTYGMEWGVNHGLLNAK
TFKPVIRRAQNYLTTVALQSDGSVGYVQPIGERAIPGQHVDKDSQADFGVGAFLLAATES
LRRQNR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	421	1.1e-65	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.09e-71	48	424	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.02e-33	204	422	130	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84432.1	1.76e-180	36	422	2	361
QVJ79822.1	5.79e-175	33	426	17	371
ADE82673.1	1.35e-173	33	422	17	367
AGB28481.1	3.05e-172	48	426	31	380
QDW22441.1	2.57e-155	36	422	32	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.60e-148	42	422	31	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.09e-134	35	422	7	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.47e-48	205	422	152	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.02e-13	202	419	136	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.63e-12	202	419	126	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.88e-47	205	422	159	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.64e-44	205	422	157	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	5.04e-42	205	421	199	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.20e-12	202	419	136	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.099032	0.884453	0.015333	0.000382	0.000348	0.000420

TMHMM  Annotations     

start	end
7	24