CAZyme Information: MGYG000001706_00410

Basic Information

• Species: Campylobacter_A curvus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A curvus
• CAZyme ID: MGYG000001706_00410
• CAZy Family: GT66
• CAZyme Description: Undecaprenyl-diphosphooligosaccharide--protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713	MGYG000001706_1|CGC2	81813.91	7.2616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001706	1971264	Isolate	South Africa	Africa

• Gene Location: Start: 422388; End: 424529 Strand: +

Full Sequence      

MDSQALNSNFRSSRQILAFILLAYLFGVICRFYWVYWASGIEQFYFNGEFITNTNDGFYN
AEGARDMLAGFHQPNDLSPYGGSIPTFTFILAKILPFKFESIIFYMSVFLSPLIVLPIIL
IAREYKITNVGIVAALIASILPGYYIRTLAGYYDSDMLNVTLPLLVVWALIRLVDRKSQN
FILPAIFMVIYDWWYQSSYSLNLALIVMFLLYTLVFDRKNETNYKAMIFMLMAVIDFDAY
SADTIVNFVFVLKAAMIGLLYVLMLLRPQMFGKKMLFCLGAFMVALFAAFGGFSSVSSKL
HFYLVKQASELNDTFYFLNVSKTIAEVKNTSISLFAVNVGGHIVVFALSCIGIVLMLVKF
RSFWLVMPMLALGCLAFVSGGRFSMYLTPITALGFGYFLYFALNLFQIRAWLKGALFWVC
TCFALVPNLEYIYRYHIPTLLGNSAISALDLLKTKASREDYVLSWWDYGYLIKYYADVKT
LSDPGRQSGTYSFLTSFALSQDQISSANMARLDVEYSERQFDEKFRFGLSEMLKDYNQTD
VNKFLNSLEDKNFKLPPKTREIYYYLLPEMVNILPEILSFSMLDITTGKEFEKPLIYIGF
PFSSDEKGLNIGEGFVLPLGDFKFITHNGEKIPINSYYQVSYIDGKLDVKANKIDENAKI
YVIFLANYNRILLLEKKAFDSTFVQLFIFENYDKELFEPVVLDQAAKIYRLLK

Enzyme Prediction     

No EC number prediction in MGYG000001706_00410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	19	610	2.4e-87	0.922077922077922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02516	STT3	3.30e-37	32	485	20	477	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG1287	Stt3	1.34e-28	16	499	22	537	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam18527	STT3_PglB_C	6.34e-16	597	673	3	79	STT3/PglB C-terminal beta-barrel domain. Asparagine-linked glycosylation is a post-translational modification of proteins containing the conserved sequence motif Asn-X-Ser/Thr. The attachment of oligosaccharides is implicated in diverse processes such as protein folding and quality control, organism development or host-pathogen interactions. The reaction is catalysed by oligosaccharyltransferase (OST), a membrane protein complex located in the endoplasmic reticulum. The central, catalytic enzyme of OST is the STT3 subunit, which has homologues in bacteria and archaea. Structural analysis of a bacterial OST, undecaprenyl-diphosphooligosaccharide protein glycotransferase EC:2.4.99.19 (PglB) protein, revealed two domains: a transmembrane domain and a periplasmic domain. This entry represents the C-terminal periplasmic beta-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAU00940.1	0.0	1	713	1	713
QKF60717.1	0.0	1	713	1	713
AKT93306.1	1.57e-273	12	713	12	726
QCD52086.1	9.97e-242	13	713	15	706
EAT99324.2	2.19e-215	15	711	9	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCE_A	1.79e-159	20	711	20	710	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
5OGL_A	5.56e-155	20	711	20	710	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
6GXC_A	7.72e-155	20	711	20	710	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	1.01e-40	438	711	8	289	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HTX9	4.46e-160	18	711	16	711	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
Q0P9C8	2.50e-159	18	711	16	711	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
B9KDD4	1.69e-156	20	711	20	710	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
16	38
101	123
130	152
157	174
194	216
244	266
275	297
333	355
362	381
386	408
415	437