CAZyme Information: MGYG000001702_02982

Basic Information

• Species: Virgibacillus picturae
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus picturae
• CAZyme ID: MGYG000001702_02982
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209	MGYG000001702_3|CGC2	23977.17	4.9853

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001702	3675175	Isolate	Saudi Arabia	Asia

• Gene Location: Start: 28137; End: 28766 Strand: -

Full Sequence      

MKLRKRHIKAIKRATILFLLFSGIFLILSFLTSEKSSITENSTKPKISEEVRQYQPLVKK
YAEQYGVGNYMDVILGIMMQESGGRGQDPMQASESYCGERNCIEDPELSIKQGVSYFSKS
LDEANGDMQLAVQSYNFGLGFIDFVHERSGQYTQETAINFSQYMYEQDPDKEKYRCLREG
SRELDACYGDIYYVKAVMGYRDVIEAEAQ

Enzyme Prediction     

No EC number prediction in MGYG000001702_02982.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	9.60e-65	54	200	1	149	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	6.51e-62	48	201	1	165	Lysozyme-like.
cd00254	LT-like	5.45e-09	74	156	4	99	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.34e-06	54	143	4	110	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.36e-06	58	142	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR00675.1	1.23e-135	1	209	1	209
AXI10718.1	8.67e-83	1	207	1	209
QTY16128.1	9.40e-82	1	207	1	208
API91914.1	9.40e-82	1	207	1	208
QRZ18631.1	5.59e-81	1	207	1	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	7.39e-21	47	161	22	138	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.33e-20	34	161	7	137	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34636	3.80e-33	22	209	23	212	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P96645	2.37e-28	47	200	53	191	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
Q99ZN9	9.41e-17	49	161	28	143	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q5XC63	3.57e-16	49	161	28	143	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	3.57e-16	49	161	28	143	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.981699	0.017568	0.000471	0.000024	0.000022	0.000237

TMHMM  Annotations     

start	end
13	32