CAZyme Information: MGYG000001702_01009

Basic Information

• Species: Virgibacillus picturae
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus picturae
• CAZyme ID: MGYG000001702_01009
• CAZy Family: GT2
• CAZyme Description: 4,4'-diaponeurosporenoate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		41812.26	9.1317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001702	3675175	Isolate	Saudi Arabia	Asia

• Gene Location: Start: 986858; End: 987979 Strand: -

Full Sequence      

MNFLFFCCVVLICAGVTCGFLMFWKILLPRRSSESQTVEGNLSIIIPARNEAKRIIPLLD
SLLSQKGIKFETILVDDGSIDETVSIAASYGVKVIRNDHLENGWLGKTAACWMGAKHASG
DWLLFLDADTQLQTPESLVQLSSTYQELGAHGILSLQPYHTIKRPYENLSAIFNIIVMVG
MNVFTVWGKKLKGAGSFGPCILCSKVDYMKSGGHQGIRNAVMDDLALGEAFRKAGYPVRC
YGGKGLINFQMYPEGLGSLWEGWTKSFATASQETHPLVTILISFWISGAFLTTPFLITAS
ILDLTMWITIATILYIIFFVQVLIFARRTGRFSTIVIALYPMLFLFFTILFIWSIYLTYI
RRTVSWRGRKIKL

Enzyme Prediction     

No EC number prediction in MGYG000001702_01009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	43	151	7.8e-24	0.6411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	5.74e-26	43	188	1	154	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
TIGR04283	glyco_like_mftF	3.67e-23	42	132	1	84	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
cd00761	Glyco_tranf_GTA_type	2.18e-22	44	130	1	88	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04179	DPM_DPG-synthase_like	1.01e-21	44	135	1	93	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd06423	CESA_like	7.38e-21	44	142	1	100	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDI90143.1	1.04e-145	19	373	20	374
APC50290.1	8.43e-136	19	373	4	357
QGM29681.1	1.32e-126	1	373	2	374
QEY22812.1	3.75e-126	1	373	2	374
AOH53234.1	2.49e-125	15	373	15	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	5.45e-07	42	129	7	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3F1Y_A	3.08e-06	42	136	96	196	Mannosyl-3-phosphoglyceratesynthase from Rubrobacter xylanophilus [synthetic construct],3F1Y_C Mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus [synthetic construct],3KIA_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus [synthetic construct],3KIA_C Crystal structure of mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus [synthetic construct],3O3P_A Crystal structure of R. xylanophilus MpgS in complex with GDP-Mannose [Rubrobacter xylanophilus],3O3P_B Crystal structure of R. xylanophilus MpgS in complex with GDP-Mannose [Rubrobacter xylanophilus]
5TZE_C	5.22e-06	43	129	4	93	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	6.83e-06	43	129	4	93	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HCY7	5.20e-69	10	373	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=crtQ PE=3 SV=2
Q2FDU4	5.20e-69	10	373	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=crtQ PE=3 SV=1
Q53590	5.20e-69	10	373	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain Newman) OX=426430 GN=crtQ PE=3 SV=2
Q2FV58	5.20e-69	10	373	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=crtQ PE=3 SV=1
Q6G6B1	5.20e-69	10	373	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=crtQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
169	188
277	299
306	325
335	357