CAZyme Information: MGYG000001698_00536

Basic Information

• Species: Marvinbryantia formatexigens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia formatexigens
• CAZyme ID: MGYG000001698_00536
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826	MGYG000001698_2|CGC1	91839.95	4.9295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001698	4516105	Isolate	United States	North America

• Gene Location: Start: 119933; End: 122413 Strand: -

Full Sequence      

MKKINIDRAWEFMLGEPSNIPGMTKQSRTVNLPHDFMIESDVKADSVNGTNTGFYDGGTA
TYTKYLEVPEEWENQRVLVEFDGAFRDTTVILNGHIMGRHHYGYTPFRTELSSRLKCGRK
NRLAVLVGNDAEPNSRWYPGGGLYRHVNLLLAPQVHIAPDGIFAHTDHIVNGDAFVTVEV
TVENHTAKEQDVWVRIALKKEDEDRSAAAWGAVKIHIPADSSAIGRTCVCAENAAIWDID
HPDLYVVTAELTDCRPAGLEEIKVLDSAETLFGIRTISVDAKNGFMLNGRSLKLKGGCIH
HDNGILGAASLYESEYRKVKLHKENGYNALRFAHNPMSADLLEVCDRLGILVMDEAFDTW
KMPKNRHDFCRHFEAEWKQEMKSFMTRDRNHPCVIIWSIGNELPEQGGLSDGYQTSAELA
EYARSLDSTRFIGGAMCSFFNGLDDEDTGKFWESLMEEAMKSGGTLNNLDGEYGRKIWND
YTEAFCAPWDVVGYNYLNYHYKEAGELFPGRVICATESKPRQGEEYWADVEKYPYLIGDF
VWTSQDYIGEAGIGKTVYAEAAEAQAEAQKLNFVQYPWRTAGAGDFDLCGFEKPQLAYHR
IIWGSKETYIACHNPANFHKVELLGRYGWSDCANSWTWDAETGCDIKVEVYSGADEVELL
INGVSAGRQSAGKEHHNKACFLVKYQPGTLEAISYTDGKEVSRDCVKSAGAPAGLKITAD
ERALRQNVLKADGQSLCFAVVEVVDADGRLIPYAETEVHAEVEGAASLAAFGTGRTATEE
NYTAGKVLSYHGRMLAVVRSGYEKGTAILRVSAEGLEGAELEITAE

Enzyme Prediction     

No EC number prediction in MGYG000001698_00536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	587	4.7e-104	0.589095744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.72e-56	10	547	19	502	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.93e-36	58	430	65	443	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	3.02e-32	715	822	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	4.77e-29	59	432	110	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.03e-26	59	402	121	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG98217.1	0.0	1	823	1	810
QUL57111.1	0.0	1	823	1	810
AHF25051.1	4.54e-236	1	826	3	821
AHF23795.1	3.79e-227	1	821	1	829
AHF24670.1	1.04e-226	4	823	1	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.20e-139	1	824	5	776	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	2.57e-139	1	824	5	776	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	1.08e-115	1	823	1	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.26e-110	2	816	8	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	2.46e-107	4	826	28	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.39e-114	10	826	51	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.08e-86	5	764	50	758	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	4.49e-46	5	768	18	693	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	6.68e-42	5	823	32	793	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	2.01e-30	29	667	81	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001698_00536.