CAZyme Information: MGYG000001697_00854

Basic Information

• Species: Erysipelatoclostridium saccharogumia
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium saccharogumia
• CAZyme ID: MGYG000001697_00854
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000001697_10|CGC1	46465.82	4.9458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001697	3141483	Isolate	Germany	Europe

• Gene Location: Start: 46795; End: 48015 Strand: -

Full Sequence      

MDNYFNVLDYGVKQDCQELQTQAFQSAIDACLKQGGGTLIVPEGKYYVGSLRLYSHMTLL
LEENARLYGSNNYQDYHDFKIPSTLGYLQNEDYIKLWNLPEYYIYGIICAFQVQDIKIIG
KCGLVINGQDCYDENGEEKFRGPMGIIFSQCEDITLLGYTFVNSANWSHQLDSCQNIIIN
NVNIKAGHDGFNLHHCSDIQISDCHLETGDDCVAGYDIRNLLVRDCYFNTACNVLRIGGN
KLIFDHCKFVGPGHYPHRSTNSYNTHAVFKYYAICCDKIREDGDDIIIKNSEFEDVTKLL
VYDQGNEKMLQNNLPLRKIVFENVKLVNLKQSSLFKGNGERCQLVIKDAFIDYCNQDAFL
VIDESIELIMDNVIFNKTTMLKINKNSLVKITNCKNLKLIEEIQND

Enzyme Prediction     

No EC number prediction in MGYG000001697_00854.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	29	376	8.6e-36	0.9353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	4.29e-32	5	239	83	350	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02188	PLN02188	2.45e-07	5	237	37	285	polygalacturonase/glycoside hydrolase family protein
PLN02155	PLN02155	6.27e-06	3	223	26	231	polygalacturonase
PLN03010	PLN03010	4.16e-05	5	214	47	233	polygalacturonase
pfam12708	Pectate_lyase_3	8.52e-05	4	59	1	58	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUJ85227.1	2.17e-133	3	391	6	394
QED59087.1	1.75e-123	2	377	6	381
AUX11711.1	1.20e-108	5	379	6	378
ASG79845.1	6.80e-103	5	381	7	383
QFR24496.1	2.84e-96	5	379	8	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	1.54e-12	2	189	42	247	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	3.78e-07	6	76	158	226	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
3JUR_A	4.20e-07	2	186	25	233	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.18e-09	6	186	64	242	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
O22818	7.15e-09	6	192	34	202	Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana OX=3702 GN=At2g43860 PE=2 SV=1
P15922	2.18e-07	6	136	153	280	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001697_00854.