CAZyme Information: MGYG000001696_03953

Basic Information

• Species: Enterococcus_A raffinosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A raffinosus
• CAZyme ID: MGYG000001696_03953
• CAZy Family: GH73
• CAZyme Description: Muramidase-2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000001696_108|CGC1	30434.86	4.9861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001696	4207346	Isolate	India	Asia

• Gene Location: Start: 1825; End: 2673 Strand: -

Full Sequence      

MNQFKTRIEKYNYIKTQQKEKRLKMAKRTVPLLGTAMILSPAVLNTNTIKASAAETGQVQ
NQSTFIEQLGASAMQVSASNDLYASIMVAQALVETGFGSSQLSAAPYYNLFGVKEYSGGP
SVTMSTQEYLNGQWVTMNEPFAVYSSYAESFQAHASLLTSSYYAGAWKSHTNSYQDAAVY
LTGRYATDPGYSSKLISLIQTYNLTRFDTPGSGTAVQAPATDVQATEQTSSSSQASGQSY
TVQSGDSIWGIAEKFGISVDQLLADNGWSSDSTIMPGDTIVI

Enzyme Prediction     

No EC number prediction in MGYG000001696_03953.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	71	204	1.2e-28	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.82e-56	21	212	2	192	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.83e-45	40	277	130	369	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	2.39e-43	35	210	294	474	amidase domain-containing protein.
smart00047	LYZ2	2.00e-32	60	208	6	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	2.00e-21	39	201	129	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZO07791.1	2.91e-193	1	282	1	282
QXJ58041.1	7.65e-189	1	282	1	282
AXG38294.1	5.28e-161	1	282	1	289
BBM18042.1	1.10e-160	1	282	1	290
QCQ13605.1	2.64e-160	1	282	1	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.37e-36	44	208	12	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	8.91e-25	65	208	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	8.11e-16	65	200	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.12e-15	65	200	6	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.85e-15	65	199	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	1.42e-56	21	282	16	298	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P37710	4.58e-54	60	282	178	404	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9CIT4	5.10e-51	6	282	4	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.03e-49	65	282	65	286	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	5.57e-49	6	270	4	275	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.044515	0.946753	0.005107	0.002883	0.000480	0.000265

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001696_03953.