CAZyme Information: MGYG000001694_00273

Basic Information

• Species: Enterococcus faecalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus faecalis
• CAZyme ID: MGYG000001694_00273
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194	MGYG000001694_1|CGC4	21137.81	9.2279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001694	2810675	Isolate	not provided	not provided

• Gene Location: Start: 264656; End: 265240 Strand: -

Full Sequence      

MKKSLLTIVLAFSFVLGGAALAPTVSEAHGYVASPGSRAFFGSSAGGNLNTNVGRAQWEP
QSIEAPKNTFITGKLASAGVSGFEPLDEQTATRWHKTNITTGPLDITWNLTAQHRTASWD
YYITKNGWNPNQPLDIKNFDKIASIDGKQEVPNKVVKQTINIPTDRKGYHVIYAVWGIGD
TVNAFYQAIDVNIQ

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	29	192	1.1e-48	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	4.29e-69	1	193	1	193	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	4.39e-62	29	192	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	4.68e-60	2	193	6	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	5.64e-51	29	191	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCJ35202.1	7.34e-141	1	194	1	194
AMR96071.1	7.34e-141	1	194	1	194
QXN80514.1	7.34e-141	1	194	1	194
QRG97861.1	7.34e-141	1	194	1	194
QFY94414.1	7.34e-141	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A02_A	2.81e-124	29	194	1	166	X-raycrystallographic structure of EfCBM33A [Enterococcus faecalis],4ALC_A X-Ray photoreduction of Polysaccharide monooxigenase CBM33 [Enterococcus faecalis],4ALE_A Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction. [Enterococcus faecalis],4ALQ_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis V583],4ALR_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALS_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALT_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis]
5L2V_A	1.24e-55	29	193	1	164	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]
2BEM_A	2.99e-47	29	194	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	1.71e-46	29	194	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
6T5Z_A	7.75e-46	29	194	1	172	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S1	1.47e-141	1	194	1	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8EHY2	1.09e-45	18	194	17	196	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q6LKG5	2.36e-37	2	191	7	200	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
Q7MEW9	8.56e-36	2	194	6	201	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1
Q8D7V4	3.19e-35	2	194	6	201	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.999023	0.000180	0.000180	0.000159	0.000143

TMHMM  Annotations     

start	end
5	22