CAZyme Information: MGYG000001692_03139

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_03139
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000001692_28|CGC3	37209.88	9.4322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 41124; End: 42128 Strand: +

Full Sequence      

MSRSLGWLVSVLLLTSPYCYSYHNYHWQAGFPTPIQGKGAELVTQQTQFLLKQRDHLQRR
LTQSQPMIRWVADQVSARKLPRMLAFLPLIESSYRLDVISAAGAAGPWQLMPDTAARFSI
PMQPGFDGRYSLPLATDAALSYLGWLHQFFGQDWLLALAAYNAGEGRVLKAVLDAGTRNI
WELQLPMETRLYVARFIALAQLLDRSEQHQITLPPWQAGENIQVATHPGSCSLLQWAMAK
GVAMNEASRWNPAWQLPDAPGVTNCPIVYSRGGSPAPTRQNSKQVFYKAVSLESLHDPLL
LQAARGLDMSKGSVRLEALQDPLGLETKRPPLVP

Enzyme Prediction     

No EC number prediction in MGYG000001692_03139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	68	207	5.8e-20	0.9259259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.38e-50	75	201	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	3.35e-41	43	214	80	255	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	9.22e-25	81	183	12	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.75e-18	91	195	11	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.00e-16	91	195	31	141	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABO88567.1	7.75e-192	1	334	1	334
AJQ56262.1	3.39e-190	51	334	1	284
QWL81654.1	3.39e-190	51	334	1	284
AUZ76882.1	1.38e-189	51	334	1	284
QWL72715.1	1.96e-189	51	334	1	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.34e-08	91	200	474	589	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.41e-08	91	200	503	618	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	7.88e-08	91	200	475	590	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	7.88e-08	91	200	474	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	4.36e-07	20	168	422	559	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.50e-32	43	214	77	252	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.50e-32	43	214	77	252	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	2.21e-21	64	172	22	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P39434	1.83e-06	91	168	505	586	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.43e-06	20	168	449	586	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999193	0.000135	0.000156	0.000134	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_03139.