CAZyme Information: MGYG000001691_00587

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_00587
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000001691_6|CGC1	63168.61	8.5339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 57587; End: 59269 Strand: -

Full Sequence      

MQSADISQRTLCWMLLLVALVLLSGQFDHQLWTPDEPREAAIALEMYRSGDWVVPTLGGR
SFVEKPPLFYMAALPFLDGFESWLGVTNSLRLAGVVWAAGMLLFTGLLAYRLLGNRSAAL
WSVIALGTMEGFIINTHWIRTDSALAFFVIFTLWAFSEYYLARRWWMAILAGIGLAGCFM
AKGPIGPLTVFFGWLPLFFFAAKCAAIDKKLPEFIWQHLLMLLCFILPVAAWIRELINHV
DGDALWDEWFWQNQVGRLTGTSTELGHIKKGAYLYYLWGMAEYTIPWLPFIFYWGWQTIK
QRRWSRERIFLLCWAVGTLVLLTLSSTKRTLYLFPLLPVFAIMLGQVSLNWPGWTARYGR
GWLCFMLLFCVVVTGTPLLGPSLPGTSHIPADVLHIAGKLGWRYIPAITLFVIALELLLR
RKEVHGAIHVASSVAIIFLLTFTLVYPLIDAAKGVSGKMALLLDRIPPETRDRIAGWRLG
ETELGLLSAYEEMRVANLDRETVRNVIACRDTRFDAVLVNGTAGERGQLLEGIPYQLLAQ
TALRSDKGQLLTLVTGLQCH

Enzyme Prediction     

No EC number prediction in MGYG000001691_00587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	448	9.9e-62	0.7962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.40e-30	29	394	28	382	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.34e-11	29	444	26	428	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.95e-06	65	232	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.98e-06	99	233	94	232	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.005	61	177	83	207	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW15123.1	4.02e-25	7	492	11	481
ANM29702.1	6.54e-24	16	454	9	452
ANQ17459.1	3.10e-23	2	417	13	435
AEX22582.1	3.10e-23	2	417	13	435
ANQ13013.1	3.10e-23	2	417	13	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.59e-06	13	345	33	361	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6D2F3	9.59e-18	17	344	19	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
A8GDR9	2.16e-16	17	348	18	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
Q2NWA9	1.50e-14	17	360	18	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1
A4SQX1	1.05e-13	13	382	6	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.84e-13	31	382	25	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.206800	0.789829	0.002422	0.000313	0.000266	0.000335

TMHMM  Annotations     

start	end
13	32
93	110
117	139
143	162
164	181
185	207
214	233
274	296
309	327
332	354
361	380
400	419
426	448