CAZyme Information: MGYG000001688_03329

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_03329
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000001688_92|CGC1	88205.5	5.7464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 89819; End: 92152 Strand: +

Full Sequence      

MNHLKYDGGTGNLKNWLIQESSFDSRFLGKCEAIFAQGNGYMGVRNALEESYPGEVRNTF
VAGTFNKASAEEVTELPNVPDMTGMTILIGGHVFNLMQGELSAYTRTMNLKNGETVREVR
WKSPGGVYTAAVFKRIVSLADEHIIAAALDLMVDKDVQIVIETGIDGTVTNSGAQHFKDL
KRRVYDGRDMQYLSRTTESDVWVAQHAACSLNLQADILPVMERRTLKNRYTFMAKAGQNI
HFEKISAIHTSRDLEYEDAKTEGIEEKLMADGLKSLRESNSKGYQGLKEASALQWEKYWR
ESGITIDGDTDFEQLAVRFSLYHLNIMAKQDDNRIGIGAKALTGEGYKGHSFWDTELFIL
PYFTFTRPGAAKSLLEYRYKNLVGARRKAKENGYEGAMYPWECAWVDDGEVTPLYKGADV
VTGKVKKVLTGLIEHHISADIAYAVWQYYLMTGDRDFMETCGYEMILDTALFWASRVQYR
KETGRYEILDVIGPDEYKEHVDNNAYTNYMANYNMHLALFIMENLLDDNTELSKRLDHKL
NLSYIKEKIDSCIDRLYLPGPDKDGIIPQTDEYLHLTKIDITKYKNSEEAKIIYKDFNAE
QINGFMVSKQADTVMLMFLFPDLFDEETRRKNFTFYEDKTLHDSSLSKCIHSIMANDLGL
TEMAYDFYKRSLMIDLGPQMKSSNEGIHSAAIGGIWESTVMGFGGVRLKGEYLHIAPKLP
KKWKKLIFPLCLKGCQLKITAAHQELVVENMGQQESSCVLNGELVSIEPGAVKRIEL

Enzyme Prediction     

No EC number prediction in MGYG000001688_03329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	318	709	4.9e-138	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	0.0	13	755	8	747	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	3.87e-144	318	713	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	1.42e-122	16	775	10	756	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	1.34e-61	20	251	2	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW77936.1	0.0	1	774	1	775
QIB53418.1	0.0	1	774	1	775
ADL03489.1	0.0	1	770	2	771
QRV18359.1	0.0	1	770	2	771
SET49151.1	0.0	1	776	2	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	8.36e-140	14	746	6	736	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	8.17e-108	35	761	33	744	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.14e-107	35	761	33	744	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	1.33e-78	16	728	10	711	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
7FE3_A	5.72e-59	39	726	43	662	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77154	1.36e-163	18	772	7	734	Kojibiose phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=ycjT PE=1 SV=1
Q8RBL8	3.32e-141	16	756	16	759	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
Q8L163	1.51e-127	16	768	19	775	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q8L164	4.09e-117	14	773	13	774	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
D6XZ22	1.88e-107	35	761	33	744	1,2-alpha-glucosylglycerol phosphorylase OS=Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10) OX=439292 GN=Bsel_2816 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_03329.